Tested Applications
| Positive WB detected in | human placenta tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
23197-1-AP targets KCTD8 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19555 Product name: Recombinant human KCTD8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 360-473 aa of BC136793 Sequence: CDSHSEASTPQDNPSSAQQATAHQPNTLTLDRPSKKAPVQWIPPPDKRRNSELFQTLISKSRETNLSKKKVCEKLSVEEEMKKCIQDFKKIHIPDYFPERKRQWQSELLQKYGL Predict reactive species |
| Full Name | potassium channel tetramerisation domain containing 8 |
| Calculated Molecular Weight | 473 aa, 52 kDa |
| Observed Molecular Weight | 52 kDa |
| GenBank Accession Number | BC136793 |
| Gene Symbol | KCTD8 |
| Gene ID (NCBI) | 386617 |
| RRID | AB_3669411 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6ZWB6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GABA-B receptors are G protein-coupled receptors for gamma-aminobutyric acid (GABA). KCTD8 appears to function as an auxiliary GABA-B receptor subunit that may influence the biophysical and/or pharmacologic properties of the receptor response.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for KCTD8 antibody 23197-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

