Tested Applications
| Positive WB detected in | MDCK cells, HEK-293 cells, MCF-7 cells |
| Positive IHC detected in | human kidney tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 6 publications below |
| WB | See 9 publications below |
| IHC | See 7 publications below |
| IF | See 3 publications below |
Product Information
17422-1-AP targets KIF26B in WB, IHC, IF, ELISA applications and shows reactivity with human, canine samples.
| Tested Reactivity | human, canine |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11446 Product name: Recombinant human KIF26B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 151-355 aa of BC042481 Sequence: AFSAVIHDKLQVPNTIRKAWNDRDNRCDICATHLNQLKQEAIQMVLTLEQAAGSEHYDASPCSPPPLSNIPTLVGSRHVGGLQQPRDWAFVPAPCATSNYTGFANKHGSKPSSLGVSNGAEKKSGSPTHQAKVSLQMATSPSNGNILNSVAIQAHQYLDGTWSLSRTNGVTLYPYQDSEALVTRGRGRLEDSAAAPALMSEDRGA Predict reactive species |
| Full Name | kinesin family member 26B |
| Calculated Molecular Weight | 2108aa,224 kDa; 162aa,17 kDa |
| Observed Molecular Weight | 224-230 kDa |
| GenBank Accession Number | BC042481 |
| Gene Symbol | KIF26B |
| Gene ID (NCBI) | 55083 |
| RRID | AB_2131762 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q2KJY2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
KIF26B is a member of kinesin-11 family and plays important role in embryogenesis. It is a downstram target of Sall1 and is essential for kidney development. KIF26B is also involved in tumorigenesis.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for KIF26B antibody 17422-1-AP | Download protocol |
| WB protocol for KIF26B antibody 17422-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun Fusobacterium nucleatum reduces METTL3-mediated m6A modification and contributes to colorectal cancer metastasis.
| ||
Biomed Pharmacother KIF26B promotes cell proliferation and migration through the FGF2/ERK signaling pathway in breast cancer. | ||
J Bone Miner Res KIF26B Silencing Prevents Osseous Transdifferentiation of Progenitor/Stem Cells and Attenuates Ectopic Calcification in a Murine Model.
| ||
J Ginseng Res Ginsenoside Rh2 reduces m6A RNA methylation in cancer via the KIF26B-SRF positive feedback loop | ||
Cell Cycle Noncoding RNAs-based high KIF26B expression correlates with poor prognosis and tumor immune infiltration in colon cancer | ||
Biochem Biophys Res Commun Novel mechanistic role of Kif26b in adipogenic differentiation of murine multipotent stromal cells.
|
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Abigail (Verified Customer) (06-17-2024) | We had a lot of issues with this antibody due to difficulties transferring the high molecular weight protein. When we were able to get a good transfer as seen on the Ponceau, it was pretty hit or miss on if the antibody worked. We only had one quantifiable blot, the rest were not able to be transferred due to poor signal.
|













