Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27470-1-AP targets KIFC2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26519 Product name: Recombinant human KIFC2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 132-254 aa of BC017311 Sequence: RSPRGRQALLQGTQPAPRVRPPSPDGSTSQEESPSHFTAVPGEPLGDETQGQQPLQLEEDQRAWQRLEQLILGQLEELKQQLEQQEEELGRLRLGVGATDSEKRVQHLTLENEALKQSLSLMR Predict reactive species |
| Full Name | kinesin family member C2 |
| Calculated Molecular Weight | 90 kDa |
| Observed Molecular Weight | 96 kDa |
| GenBank Accession Number | BC017311 |
| Gene Symbol | KIFC2 |
| Gene ID (NCBI) | 90990 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96AC6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Kinesin family member C2 (KIFC2), one of the kinesin-14 motor family members, is especially expressed in neurons and is important for organizing dendritic microtubules and to control dendrite development (PMID: 37716704). KIFC2 is a microtubule-binding protein that functions as a motor protein in vesicle transport along axons and/or dendrites. Western blot analysis detected KIFC2 at an apparent molecular mass of 96 kD(PMID: 9115737).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for KIFC2 antibody 27470-1-AP | Download protocol |
| WB protocol for KIFC2 antibody 27470-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



