KL Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87584-1-RR (same clone as 87584-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87584-1-RR (KL antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87584-1-PBS in a different storage buffer formulation.

KL Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87584-1-PBS

Clone No.252897B7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

alpha klotho, klotho, α klotho, α-klotho

---

Product Information

87584-1-PBS targets KL in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag27759

  Product name: Recombinant human KL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 34-184 aa of NM_004795

  Sequence: MEPGDGAQTWARFSRPPAPEAAGLFQGTFPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLPLGAPSPLQPATGDVASDSYNNVFRDTEALRELGVTHYRFSISWARVLPNGSAGVPNREGLRYYRRLLERLRELG

• Full Name: klotho
• Calculated Molecular Weight: 116 kDa
• Observed Molecular Weight: 130-150 kDa
• GenBank Accession Number: NM_004795
• Gene Symbol: KL
• Gene ID (NCBI): 9365
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UEF7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.