KLF2 Polyclonal antibody

• 

  WB analysis using 31170-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31170-1-AP (KLF2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

KLF2 Polyclonal Antibody for WB, ELISA

Cat No. 31170-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

Krueppel like factor 2, Krueppel-like factor 2, Kruppel like factor 2 (lung), LKLF, Lung krueppel like factor

---

Tested Applications

• Positive WB detected in: bEnd.3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31170-1-AP targets KLF2 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33962

  Product name: Recombinant human KLF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 90-225 aa of NM_016270

  Sequence: GLVSELLRPELDAPLGPALHGRFLLAPPGRLVKAEPPEADGGGGYGCAPGLTRGPRGLKREGAPGPAASCMRGPGGRPPPPPDTPPLSPDGPARLPAPGPRASFPPPFGGPGFGAPGPGLHYAPPAPPAFGLFDDA

• Full Name: Kruppel-like factor 2 (lung)
• Calculated Molecular Weight: 37KD
• Observed Molecular Weight: 37-40 kDa
• GenBank Accession Number: NM_016270
• Gene Symbol: KLF2
• Gene ID (NCBI): 10365
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9Y5W3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.