Use Able AI chat for product recommendations

KLF9 Recombinant monoclonal antibody, PBS Only (Detector)

KLF9 Uni-rAb® Recombinant Antibody for WB, FC (Intra), Cytometric bead array, Indirect ELISA

Cat No. 83183-4-PBS
Clone No.230436H2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), Cytometric bead array, Indirect ELISA

230436H2, Basic transcription element-binding protein 1, BTEB, BTEB1, BTE-binding protein 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83183-4-PBS targets KLF9 as part of a matched antibody pair:

MP00148-1: 83183-3-PBS capture and 83183-4-PBS detection (validated in Cytometric bead array)

MP00148-2: 83183-2-PBS capture and 83183-4-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34411

Product name: Recombinant human KLF9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-150 aa of BC074880

Sequence: MSAAAYMDFVAAQCLVSISNRAAVPEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDMGSDSDVTTESGSSPSHSPEERQDPGSAPSPLSLLHPGVAAKGKHASEKRHKCPYSGC

Predict reactive species
Full Name Kruppel-like factor 9
Calculated Molecular Weight27 kDa
GenBank Accession NumberBC074880
Gene Symbol KLF9
Gene ID (NCBI) 687
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13886
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Krüppel-like factor 9 (KLF9) was a member of SP/KLF family of DNA-binding transcriptional regulators featured by a highly homologous C-terminal three C2H2-type zinc finger DNA-binding domains. KLF9 has been previously reported to be downregulated in various types of human malignancy and serves as a tumour suppressor at tumour onset and development, affecting cell proliferation, apoptosis, metastasis and tumorigenicity (PMID: 32855660).

Loading...
||
New chat

Able

正在加载,请稍候...