KLHL25 Monoclonal antibody, PBS Only

• 

  WB analysis using 67774-1-Ig (same clone as 67774-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67774-1-Ig (KLHL25 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67774-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HT-29 using 67774-1-Ig (same clone as 67774-1-PBS)

  HT-29 cells were subjected to SDS PAGE followed by western blot with 67774-1-Ig (KLHL25 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67774-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 67774-1-Ig (same clone as 67774-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 67774-1-Ig (KLHL25 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67774-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 67774-1-Ig (same clone as 67774-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 67774-1-Ig (KLHL25 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67774-1-PBS in a different storage buffer formulation.

KLHL25 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67774-1-PBS

Clone No.1D8B8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

1D8B8, Ectoderm-neural cortex protein 2, ENC 2, ENC2, ENC-2

---

Product Information

67774-1-PBS targets KLHL25 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27037

  Product name: Recombinant human KLHL25 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 162-260 aa of BC028100

  Sequence: RRLYEFSWRMCLVHFETVRQSEDFNSLSKDTLLDLISSDELETEDERVVFEAILQWVKHDLEPRKVHLPELLRSVRLALLPSDCLQEAVSSEALLMADE

• Full Name: kelch-like 25 (Drosophila)
• Observed Molecular Weight: 66 kDa
• GenBank Accession Number: BC028100
• Gene Symbol: KLHL25
• Gene ID (NCBI): 64410
• RRID: AB_2918539
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9H0H3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.