Product Information
67774-1-PBS targets KLHL25 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag27037 Product name: Recombinant human KLHL25 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 162-260 aa of BC028100 Sequence: RRLYEFSWRMCLVHFETVRQSEDFNSLSKDTLLDLISSDELETEDERVVFEAILQWVKHDLEPRKVHLPELLRSVRLALLPSDCLQEAVSSEALLMADE Predict reactive species |
Full Name | kelch-like 25 (Drosophila) |
Observed Molecular Weight | 66 kDa |
GenBank Accession Number | BC028100 |
Gene Symbol | KLHL25 |
Gene ID (NCBI) | 64410 |
RRID | AB_2918539 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q9H0H3 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |