KLK3/PSA Polyclonal antibody, PBS Only

• 

  WB analysis using 10679-1-AP (same clone as 10679-1-PBS)

  DU 145(PSA-), PC-3(PSA-) and LNCaP (PSA+) cell lysates were subjected to SDS PAGE followed by western blot with 10679-1-AP (KLK3/PSA antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10679-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Transfected HEK-293 using 10679-1-AP (same clone as 10679-1-PBS)

  Transfected HEK-293 cells were subjected to SDS PAGE followed by western blot with 10679-1-AP (KLK3/PSA antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10679-1-PBS in a different storage buffer formulation.

• 

  IP experiment of LNCaP using 10679-1-AP (same clone as 10679-1-PBS)

  IP result of anti-KLK3/PSA (IP:10679-1-AP, 4ug; Detection:10679-1-AP 1:10000) with LNCaP cells lysate 1520 ug. This data was developed using the same antibody clone with 10679-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 10679-1-AP (same clone as 10679-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 10679-1-AP (KLK3/PSA antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10679-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 10679-1-AP (same clone as 10679-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 10679-1-AP (KLK3/PSA antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10679-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 10679-1-AP (same clone as 10679-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 10679-1-AP (KLK3/PSA antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10679-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 10679-1-AP (same clone as 10679-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 10679-1-AP (KLK3/PSA antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10679-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 10679-1-AP (same clone as 10679-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 10679-1-AP (KLK3/PSA antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10679-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 10679-1-AP (same clone as 10679-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 10679-1-AP (KLK3/PSA antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 10679-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 10679-1-AP (same clone as 10679-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 10679-1-AP (KLK3/PSA antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 10679-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 10679-1-AP (same clone as 10679-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 10679-1-AP (KLK3/PSA antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 10679-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 10679-1-AP (same clone as 10679-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 10679-1-AP (KLK3/PSA antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 10679-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 10679-1-AP (same clone as 10679-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 10679-1-AP (KLK3/PSA antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 10679-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 10679-1-AP (same clone as 10679-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 10679-1-AP (KLK3/PSA antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 10679-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse prostate using 10679-1-AP (same clone as 10679-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse prostate tissue using KLK3/PSA antibody (10679-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10679-1-PBS in a different storage buffer formulation.

• 

  IF Staining of LNCaP using 10679-1-AP (same clone as 10679-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed LNCaP cells using KLK3/PSA antibody (10679-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 10679-1-PBS in a different storage buffer formulation.

KLK3/PSA Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, Indirect ELISA

Cat No. 10679-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IF-P, IP, Indirect ELISA

Synonyms

KLK3, APS, EC:3.4.21.77, Gamma-seminoprotein, Kallikrein 3

---

Product Information

10679-1-PBS targets KLK3/PSA in WB, IHC, IF/ICC, IF-P, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1060

  Product name: Recombinant human KLK3,PSA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-261 aa of BC005307

  Sequence: MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP

• Full Name: kallikrein-related peptidase 3
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 30-34 kDa
• GenBank Accession Number: BC005307
• Gene Symbol: KLK3
• Gene ID (NCBI): 354
• RRID: AB_2134244
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P07288
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KLK3 also known as Prostate-Specific Antigen (PSA), is a 33 kDa glycoprotein primarily synthesized by the epithelial cells of the prostate gland. Its main physiological function is to cleave seminogelins I and II in semen, leading to the liquefaction of the seminal coagulum and the release of motile sperm. It is under tight regulation by androgens via the androgen receptor (AR). Serum PSA levels are elevated in prostate cancer due to disruption of the glandular architecture, allowing more PSA to enter the bloodstream. It is used alongside digital rectal exam (DRE) for early detection. Although termed "prostate-specific," PSA is not exclusively produced by the prostate. Very low levels can be produced in periurethral glands, breast tissue, and some other tissues. Its expression is highly abundant in prostatic tissue and seminal fluid.