KLK8 Monoclonal antibody

• 

  WB analysis using 68247-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68247-1-Ig (KLK8 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of EC109 using 68247-1-Ig

  EC109 cells were subjected to SDS PAGE followed by western blot with 68247-1-Ig (KLK8 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 68247-1-Ig

  A431 cells were subjected to SDS PAGE followed by western blot with 68247-1-Ig (KLK8 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human cervical cancer using 68247-1-Ig

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 68247-1-Ig (KLK8 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human cervical cancer using 68247-1-Ig

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 68247-1-Ig (KLK8 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 68247-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68247-1-Ig (KLK8 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 68247-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68247-1-Ig (KLK8 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of SH-SY5Y using 68247-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed SH-SY5Y cells using KLK8 antibody (68247-1-Ig, Clone: 2F3A8 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of SH-SY5Y using 68247-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed SH-SY5Y cells using KLK8 antibody (68247-1-Ig, Clone: 2F3A8 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

KLK8 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 68247-1-Ig

Clone No.2F3A8

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Kallikrein 8, Kallikrein-8, Kallikrein8, kallikrein related peptidase 8, EC:3.4.21.118

---

Tested Applications

• Positive WB detected in: Jurkat cells, A431 cells, EC109 cells, MOLT-4 cells, NK-92 cells
• Positive IHC detected in: human cervical cancer tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68247-1-Ig targets KLK8 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5642

  Product name: Recombinant human KLK8 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-260 aa of BC040887

  Sequence: MGRPRPRAAKTWMFLLLLGGAWAGHSRAQEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDVMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG

• Full Name: kallikrein-related peptidase 8
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC040887
• Gene Symbol: KLK8
• Gene ID (NCBI): 11202
• RRID: AB_2935333
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O60259
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KLK8(Kallikrein-8) is also named as NRPN, PRSS19, TADG14.It is a new member of the human kallikrein family, which is predicted to be secreted and expected to be present in biological fluids (PMID:12507964).The protein is detectable in ovarian cancer tissue extracts, serum, and ascites fluid, indicating that it may serve as a new ovarian cancer marker (PMID:12782581). KLK8 has one predicted glycosylation site (PMID:20940292) and it has some isoforms produced by alternative splicing.