CoraLite® Plus 488-conjugated KLRG1 Recombinant monoclonal antibody

KLRG1 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-84785-5
Clone No.242327A4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

242327A4, CLEC15A, C-type lectin domain family 15 member A, ITIM-containing receptor MAFA-L, Killer cell lectin-like receptor subfamily G member 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inJurkat cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84785-5 targets KLRG1 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2036

Product name: Recombinant Human KLRG1 protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-N-rFc

Tag: N-rFc

Domain: 60-195 aa of NM_005810.4

Sequence: LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF

Predict reactive species
Full Name killer cell lectin-like receptor subfamily G, member 1
Calculated Molecular Weight22 kDa
GenBank Accession NumberNM_005810.4
Gene Symbol KLRG1
Gene ID (NCBI) 10219
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96E93-1
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

KLRG1 (killer cell lectin-like receptor subfamily G, member 1) is a C-type lectin inhibitory receptor that contains an immunoreceptor tyrosine-based inhibitory motif (ITIM) in its cytoplasmic domain. KLRG1 is expressed by subsets of NK and T cells, existing both as a monomer and as a disulfide-linked homodimer (PMID: 10741410; 19604491). It is considered to be a cell differentiation marker for NK and T cells and is strongly induced by viral and other infections (PMID: 20373518). Through interactions with members of the cadherin family, KLRG1 plays an inhibitory role on NK- and T-cell function (PMID: 19009530; 20373518).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 KLRG1 antibody CL488-84785-5Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...