Tested Applications
| Positive WB detected in | PC-3 cells, SKOV-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
| IHC | See 3 publications below |
| IF | See 1 publications below |
Product Information
60029-1-Ig targets KMO in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1109 Product name: Recombinant human KMO protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 107-407 aa of BC005297 Sequence: LSVSRENLNKDLLTAAEKYPNVKMHFNHRLLKCNPEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKKPRFDYSQQYIPHGYMELTIPPKNGDYAMEPNYLHIWPRNTFMMIALPNMNKSFTCTLFMPFEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLLPAQPMISVKCSSFHFKSHCVLLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFSNDLSLCLPVFSRLRIPDDHAISDLSMYNYIEKNMERFLHAIMPSTFIPLYTMVTFSRIRYHEAVQRWHWQKR Predict reactive species |
| Full Name | kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) |
| Calculated Molecular Weight | 486 aa, 56 kDa |
| Observed Molecular Weight | 56 kDa |
| GenBank Accession Number | BC005297 |
| Gene Symbol | KMO |
| Gene ID (NCBI) | 8564 |
| RRID | AB_2133396 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | O15229 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
KMO(Kynurenine 3-monooxygenase) is a membrane protein located on the outer membrane of mitochondria. Tissue distribution studies have revealed that, in rats, highest enzyme activity is found in kidney and liver, with brain having the least activity in comparison to peripheral organs(PMID: 9237672).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for KMO antibody 60029-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Neuro Oncol Molecular imaging correlates of tryptophan metabolism via the kynurenine pathway in human meningiomas. | ||
Oncol Lett Viability of diffuse large B-cell lymphoma cells is regulated by kynurenine 3-monooxygenase activity | ||
Hum Mol Genet Retention of stress susceptibility in the mdx mouse model of Duchenne muscular dystrophy after PGC-1α overexpression or ablation of IDO1 or CD38 | ||
Br J Pharmacol Chronic stress induces behavioural changes through increased kynurenic acid by downregulation of kynurenine-3-monooxygenase with microglial decline | ||
J Pharmacol Sci Thrombin-induced kynurenine 3-monooxygenase causes variations in the kynurenine pathway, leading to neurological deficits in a murine intracerebral hemorrhage model |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Hala (Verified Customer) (06-07-2022) | Works very good
|

