Tested Applications
| Positive WB detected in | LNCaP cells, HSC-T6 cells, HepG2 cells, HeLa cells, Jurkat cells, K-562 cells, PC-12 cells, NIH/3T3 cells |
| Positive IHC detected in | mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:1500-1:6000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below |
| IF | See 2 publications below |
Product Information
67892-1-Ig targets KPNA3 in WB, IHC, IF, ELISA applications and shows reactivity with Human, rat, mouse samples.
| Tested Reactivity | Human, rat, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27767 Product name: Recombinant human KPNA3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 322-453 aa of BC017355 Sequence: VLNCDVLSHFPNLLSHPKEKINKEAVWFLSNITAGNQQQVQAVIDAGLIPMIIHQLAKGDFGTQKEAAWAISNLTISGRKDQVEYLVQQNVIPPFCNLLSVKDSQVVQVVLDGLKNILIMAGDEASTIAEII Predict reactive species |
| Full Name | karyopherin alpha 3 (importin alpha 4) |
| Calculated Molecular Weight | 58 kDa |
| Observed Molecular Weight | 58 kDa |
| GenBank Accession Number | BC017355 |
| Gene Symbol | KPNA3 |
| Gene ID (NCBI) | 3839 |
| RRID | AB_2918648 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O00505 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
karyopherin subunit alpha 3 (KPNA3) is a member of the importin alpha family which can transport molecules between the mucleus and cytoplasm. It is ubiquitous expressed in brain,testis and esophagus. KPNA3 is associated with many severe diseases such as hepatocellular Carcinoma (PMID: 31417635) , schizophrenia, major depression and opiate dependence (PMID: 22960338) . The molecular weight of KPNA3 is about 58 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for KPNA3 antibody 67892-1-Ig | Download protocol |
| WB protocol for KPNA3 antibody 67892-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Mol Life Sci MERS-CoV-nsp5 expression in human epithelial BEAS 2b cells attenuates type I interferon production by inhibiting IRF3 nuclear translocation | ||
Int J Biol Sci De-succinylation-induced accumulation of TRMT10C in the nucleus plays a detrimental role in coronary microembolization via its m1A modification function | ||
Exp Neurol SDF2L1 downregulation mediates high glucose-caused Schwann cell dysfunction by inhibiting nuclear import of TFEB and CREB via KPNA3 | ||
J Biol Chem Direct Observation of Importin α Family Member KPNA1 in Axonal Transport With or Without a Schizophrenia-Related Mutation |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Daulet (Verified Customer) (02-09-2022) | It worked on the lysates of SH-SY5Y cells. So, if you are going to use it on this sample, then I can recommend it. However, bear in mind, that whether it will work or not depends on how you treat your samples and other protocol niceties.
|









