Product Information
67892-1-PBS targets KPNA3 in WB, IHC, ELISA applications and shows reactivity with Human, rat, mouse samples.
Tested Reactivity | Human, rat, mouse |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag27767 Product name: Recombinant human KPNA3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 322-453 aa of BC017355 Sequence: VLNCDVLSHFPNLLSHPKEKINKEAVWFLSNITAGNQQQVQAVIDAGLIPMIIHQLAKGDFGTQKEAAWAISNLTISGRKDQVEYLVQQNVIPPFCNLLSVKDSQVVQVVLDGLKNILIMAGDEASTIAEII Predict reactive species |
Full Name | karyopherin alpha 3 (importin alpha 4) |
Calculated Molecular Weight | 58 kDa |
Observed Molecular Weight | 58 kDa |
GenBank Accession Number | BC017355 |
Gene Symbol | KPNA3 |
Gene ID (NCBI) | 3839 |
RRID | AB_2918648 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | O00505 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
karyopherin subunit alpha 3 (KPNA3) is a member of the importin alpha family which can transport molecules between the mucleus and cytoplasm. It is ubiquitous expressed in brain,testis and esophagus. KPNA3 is associated with many severe diseases such as hepatocellular Carcinoma (PMID: 31417635) , schizophrenia, major depression and opiate dependence (PMID: 22960338) . The molecular weight of KPNA3 is about 58 kDa.