Tested Applications
Positive WB detected in | HeLa cells, MCF-7 cells |
Positive IHC detected in | human bowen disease, human cervical cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
22230-1-AP targets Cytokeratin 17 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag17575 Product name: Recombinant human KRT17 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-87 aa of BC000159 Sequence: MTTSIRQFTSSSSIKGSSGLGGGSSRTSCRLSGGLGAGSCRLGSAGGLGSTLGGSSYSSCYSFGSGGGYGSSFGGVDGLLAGGEKAT Predict reactive species |
Full Name | keratin 17 |
Calculated Molecular Weight | 432 aa, 48 kDa |
Observed Molecular Weight | 48 kDa |
GenBank Accession Number | BC000159 |
Gene Symbol | Cytokeratin 17 |
Gene ID (NCBI) | 3872 |
RRID | AB_2879040 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q04695 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. Keratin 17 is a type I cytokeratin. It is found in nail beds, hair follicles, sebaceous glands, and other epidermal appendages. It is used as a marker for trauma.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Cytokeratin 17 antibody 22230-1-AP | Download protocol |
IHC protocol for Cytokeratin 17 antibody 22230-1-AP | Download protocol |
IF protocol for Cytokeratin 17 antibody 22230-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |