Cytokeratin 17 Polyclonal antibody

• 

  WB analysis of HeLa using 22230-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 22230-1-AP (Cytokeratin 17 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 22230-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 22230-1-AP (Cytokeratin 17 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human cervical cancer using 22230-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 22230-1-AP (Cytokeratin 17 antibody at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human cervical cancer using 22230-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 22230-1-AP (Cytokeratin 17 antibody at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human bowen disease using 22230-1-AP

  Immunohistochemical analysis of paraffin-embedded human bowen disease slide using 22230-1-AP (Cytokeratin 17 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human bowen disease using 22230-1-AP

  Immunohistochemical analysis of paraffin-embedded human bowen disease slide using 22230-1-AP (Cytokeratin 17 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 22230-1-AP

  Immunofluorescent analysis of HeLa cells using 22230-1-AP (Cytokeratin 17 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

Cytokeratin 17 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 22230-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

KRT17, Keratin-17, keratin 17, Cytokeratin-17, Cytokeratin,Keratin

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells
• Positive IHC detected in: human bowen disease, human cervical cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22230-1-AP targets Cytokeratin 17 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17575

  Product name: Recombinant human KRT17 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-87 aa of BC000159

  Sequence: MTTSIRQFTSSSSIKGSSGLGGGSSRTSCRLSGGLGAGSCRLGSAGGLGSTLGGSSYSSCYSFGSGGGYGSSFGGVDGLLAGGEKAT

• Full Name: keratin 17
• Calculated Molecular Weight: 432 aa, 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC000159
• Gene Symbol: Cytokeratin 17
• Gene ID (NCBI): 3872
• RRID: AB_2879040
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q04695
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. Keratin 17 is a type I cytokeratin. It is found in nail beds, hair follicles, sebaceous glands, and other epidermal appendages. It is used as a marker for trauma.