Tested Applications
| Positive WB detected in | A431 cells, human bladder tissue |
| Positive IHC detected in | human cervical cancer tissue, human bowen disease Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse skin tissue |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
16572-1-AP targets Cytokeratin 4 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9854 Product name: Recombinant human KRT4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 184-534 aa of BC042174 Sequence: NLLQQQTTTTSSKNLEPLFETYLSVLRKQLDTLGNDKGRLQSELKTMQDSVEDFKTKYEEEINKRTAAENDFVVLKKDVDAAYLNKVELEAKVDSLNDEINFLKVLYDAELSQMQTHVSDTSVVLSMDNNRNLDLDSIIAEVRAQYEEIAQRSKAEAEALYQTKVQQLQISVDQHGDNLKNTKSEIAELNRMIQRLRAEIENIKKQCQTLQVSVADAEQRGENALKDAHSKRVELEAALQQAKEELARMLREYQELMSVKLALDIEIATYRKLLEGEEYRMSGECQSAVSISVVSGSTSTGGISGGLGSGSGFGLSSGFGSGSGSGFGFGGSVSGSSSSKIISTTTLNKRR Predict reactive species |
| Full Name | keratin 4 |
| Calculated Molecular Weight | 534 aa, 57 kDa |
| Observed Molecular Weight | 57 kDa |
| GenBank Accession Number | BC042174 |
| Gene Symbol | Cytokeratin 4 |
| Gene ID (NCBI) | 3851 |
| RRID | AB_2134041 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P19013 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. Keratin 4 is a type II cytokeratins. It is specifically found in differentiated layers of the mucosal and esophageal epithelia together with keratin 13.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Cytokeratin 4 antibody 16572-1-AP | Download protocol |
| IHC protocol for Cytokeratin 4 antibody 16572-1-AP | Download protocol |
| WB protocol for Cytokeratin 4 antibody 16572-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Cytokeratin 4 Polyclonal antibody (Cat# 16572-1-AP) has 9 total citations published in journals including Nature, Cell Reports, British Journal of Cancer, Development, International Journal of Molecular Sciences, Experimental Cell Research, Annals of Diagnostic Pathology, and Oncotarget. The cited research spans airway/pulmonary biology, ovarian and head-and-neck cancers, skin organoids, mucociliary differentiation, stem cell differentiation, oral pathology, and epithelial-mesenchymal transition.
| Species | Application | Title |
|---|---|---|
Nature A single-cell atlas of the airway epithelium reveals the CFTR-rich pulmonary ionocyte. | ||
Br J Cancer Proteomics analysis of serum extracellular vesicle identifies UCHL1 as a potential therapeutic target for high grade serous ovarian cancer. | ||
Cell Rep An Immunocompetent Mouse Model of HPV16(+) Head and Neck Squamous Cell Carcinoma. | ||
Int J Mol Sci Early Clinical Outcomes of the First Commercialized Human Autologous Ex Vivo Cultivated Oral Mucosal Epithelial Cell Transplantation for Limbal Stem Cell Deficiency: Two Case Reports and Literature Review | ||
Development Novel dynamics of human mucociliary differentiation revealed by single-cell RNA sequencing of nasal epithelial cultures. |
