Tested Applications
| Positive IHC detected in | human tonsillitis tissue, human ovary cancer tissue, human rectal cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:1000-1:5000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:1000-1:4000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.2 μg per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IHC | See 1 publications below |
Product Information
66555-6-Ig targets Ki-67 in IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26266 Product name: Recombinant human KI67 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1201-1300 aa of NM_002417 Sequence: AGTLPGSKRQLQTPKEKAQALEDLAGFKELFQTPGHTEELVAAGKTTKIPCDSPQSDPVDTPTSTKQRPKRSIRKADVEGELLACRNLMPSAGKAMHTPK Predict reactive species |
| Full Name | antigen identified by monoclonal antibody Ki-67 |
| Calculated Molecular Weight | 359 kDa |
| GenBank Accession Number | NM_002417 |
| Gene Symbol | KI67 |
| Gene ID (NCBI) | 4288 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P46013 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The Ki-67 protein (also known as MKI67) is a cellular marker for proliferation. Ki67 is present during all active phases of the cell cycle (G1, S, G2 and M), but is absent in resting cells (G0). Cellular content of Ki-67 protein markedly increases during cell progression through S phase of the cell cycle. Therefore, the nuclear expression of Ki67 can be evaluated to assess tumor proliferation by immunohistochemistry. It has been demonstrated to be of prognostic value in breast cancer. In head and neck cancer, several studies have reported an association between high proliferative activity and poorer prognosis.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Ki-67 antibody 66555-6-Ig | Download protocol |
| IHC protocol for Ki-67 antibody 66555-6-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Front Bioeng Biotechnol Engineering a 3D wounded skin equivalent to study early inflammatory and regenerative responses in vitro | ||
J Pathol Transl Med Unraveling the crucial role of CCL3 in nasopharyngeal carcinoma: bioinformatics and immunohistochemical insights |

















