Use Able AI chat for product recommendations

Ki-67 Monoclonal antibody

Ki67 antibodies are widely used as markers for cell proliferation, enabling the detection and quantification of actively dividing cells in tissue samples for research and diagnostic applications, especially in cancer pathology. Proteintech has an extensive range of Ki-67 antibodies validated for WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), ELISA, Cell treatment and more.

Cat No. 66555-6-Ig
Clone No.1B9H2

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

IHC, IF/ICC, IF-P, FC (Intra), ELISA

KI67, MKI67, 1B9H2, Antigen identified by monoclonal antibody Ki-67, Antigen KI-67

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman tonsillitis tissue, human ovary cancer tissue, human rectal cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman ovary cancer tissue
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inA431 cells

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:1000-1:5000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:1000-1:4000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.2 μg per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66555-6-Ig targets Ki-67 in IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag26266

Product name: Recombinant human KI67 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1201-1300 aa of NM_002417

Sequence: AGTLPGSKRQLQTPKEKAQALEDLAGFKELFQTPGHTEELVAAGKTTKIPCDSPQSDPVDTPTSTKQRPKRSIRKADVEGELLACRNLMPSAGKAMHTPK

Predict reactive species
Full Name antigen identified by monoclonal antibody Ki-67
Calculated Molecular Weight 359 kDa
GenBank Accession NumberNM_002417
Gene Symbol KI67
Gene ID (NCBI) 4288
RRIDAB_3743304
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP46013
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The Ki-67 protein (also known as MKI67) is a cellular marker for proliferation. Ki67 is present during all active phases of the cell cycle (G1, S, G2 and M), but is absent in resting cells (G0). Cellular content of Ki-67 protein markedly increases during cell progression through S phase of the cell cycle. Therefore, the nuclear expression of Ki67 can be evaluated to assess tumor proliferation by immunohistochemistry. It has been demonstrated to be of prognostic value in breast cancer. In head and neck cancer, several studies have reported an association between high proliferative activity and poorer prognosis.

Protocols

Product Specific Protocols
IF protocol for Ki-67 antibody 66555-6-IgDownload protocol
IHC protocol for Ki-67 antibody 66555-6-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

PLoS One

STAG2 mutations in the normal colon induce upregulation of oncogenic pathways in neighbouring wildtype cells.

Authors - Wei Ni Yew
mouseIHC

Funct Integr Genomics

DDX1 facilitates lenvatinib resistance in hepatocellular carcinoma through regulating ephrin-A3 and activating the Wnt/β-catenin signaling pathway.

Authors - Shenglan Huang
IHC

J Pathol Transl Med

Unraveling the crucial role of CCL3 in nasopharyngeal carcinoma: bioinformatics and immunohistochemical insights

Authors - Xiaopeng Guo
humanIHC

Int Immunopharmacol

Development and In vitro antitumor evaluation of a novel anti-p16 antibody fragment-drug conjugate.

Authors - Hui He

Front Bioeng Biotechnol

Engineering a 3D wounded skin equivalent to study early inflammatory and regenerative responses in vitro

Authors - Rima Nuwayhid
Loading...
||
New chat

Able

正在加载,请稍候...