Product Information
66269-1-PBS targets L2HGDH in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, pig samples.
| Tested Reactivity | human, pig |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8382 Product name: Recombinant human L2HGDH protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-351 aa of BC006117 Sequence: MVPALRYLVGACGRARGRFAGGSPGACGFASGRPRPLCGGSRSASTSSFDIVIVGGGIVGLASARALILRHPSLSIGVLEKEKDLAVHQTGHNSGVIHSGIYYKPESLKAKLCVQGAALLYEYCQQKGISYKQCGKLIVAVEQEEIPRLQALYEKGLQNGVPGLRLIQQEDIKKKEPYCRGLMAIDCPHTGIVDYRQVALSFAQDFQEAGGSVLTNFEVKGIEMAKESPSRSIDGMQYPIVIKNTKGEEIRCQYVVTCAGLYSDRISELSGCTPDPRIVPFRGDYLLLKPEKCYLVKGNIYPVPDSRFPFLGVHFTPRMDGSIWLGPNAVLAFKREGYRPFDFSATDVMDI Predict reactive species |
| Full Name | L-2-hydroxyglutarate dehydrogenase |
| Calculated Molecular Weight | 463aa,50 kDa; 441aa,49 kDa |
| Observed Molecular Weight | 45 kDa |
| GenBank Accession Number | BC006117 |
| Gene Symbol | L2HGDH |
| Gene ID (NCBI) | 79944 |
| RRID | AB_2881654 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9H9P8 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
L2HGDH(L-2-hydroxyglutarate dehydrogenase, mitochondrial) is also named as duranin, C14orf160 and belongs to the L2HGDH family. The putative L2HGDH is predicted to be targeted to the mitochondria where its mitochondrial targeting sequence is presumably removed(PMID:16005139). Defects in L2HGDH are the cause of L-2-hydroxyglutaric aciduria (L2HGA). It has 2 isoforms produced by alternative splicing with the molecular weight of 50 kDa and 48 kDa. L2HGDH also can be detected as ~45kD due to the 51aa transit peptide cleaved.











