Use Able AI chat for product recommendations

LAG-3/CD223 Polyclonal antibody

LAG-3/CD223 Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 16616-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, ELISA

CD223, LAG3, FDC, LAG 3, LAG-3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inPHA treated human PBMCs
Positive IP detected inmouse liver tissue
Positive IHC detected inhuman tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16616-1-AP targets LAG-3/CD223 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9909

Product name: Recombinant human LAG3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 27-360 aa of BC052589

Sequence: AEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITGQPQVGKE

Predict reactive species
Full Name lymphocyte-activation gene 3
Calculated Molecular Weight 525 aa, 57 kDa
Observed Molecular Weight60-70 kDa
GenBank Accession NumberBC052589
Gene Symbol LAG-3
Gene ID (NCBI) 3902
RRIDAB_2133350
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP18627
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LAG-3, also known as CD223, is an immune checkpoint molecule that regulates both T-cell activation and homeostasis. LAG-3 is expressed on activated T cells, NK cells, regulatory T cells, and plasmacytoid dendritic cells. It is a CD4-related molecule that binds MHC class II. LAG-3 plays an important role in modulating T cell expansion and function, and blockade of LAG-3 with monoclonal antibodies can augment T cell function. (PMID: 15634887; 21086108; 28783703)

Protocols

Product Specific Protocols
IF protocol for LAG-3/CD223 antibody 16616-1-APDownload protocol
IHC protocol for LAG-3/CD223 antibody 16616-1-APDownload protocol
IP protocol for LAG-3/CD223 antibody 16616-1-APDownload protocol
WB protocol for LAG-3/CD223 antibody 16616-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cancer Immunol Immunother

Novel roles of VAT1 expression in the immunosuppressive action of diffuse gliomas.

Authors - Pei Yang
humanIHC

Ann Transl Med

Single-cell RNA-seq reveals transcriptional landscape and intratumor heterogenicity in gallbladder cancer liver metastasis microenvironment.

Authors - Yigang Zhang
humanIHC

Eur J Med Res

Single-cell combined bioinformatics analysis: construction of immune cluster and risk prognostic model in kidney renal clear cells based on CD8(+) T cell-associated genes.

Authors - Haifeng Gao
humanWB

J Clin Invest

Targeting fibrinogen-like protein 1 enhances immunotherapy in hepatocellular carcinoma

Authors - Mingen Lin

Tissue Cell

Adiponectin attenuates atherosclerosis via macrophage polarization-mediated T Cell exhaustion by modulating the NF-κB p65/PI3K/Akt signaling pathway

Authors - Man Qin
humanIHC

Discov Oncol

Pan-cancer multi-omics profiling of gasdermins identifies GSDMD as an immune-related prognostic biomarker in kidney renal clear cell carcinoma.

Authors - Yu Liu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Sofia (Verified Customer) (05-27-2025)

Antibody did not work as expected even using the suggested antigen retrieval. I'll try it again using a different antigen retrieval.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: Brain samples
FH

Eman (Verified Customer) (09-20-2021)

the antibody works very well for WB the recommended dilution is 1:500 to 1:1000 i think we can even dilute it more this antibody is higly recommended

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000 overnight
  • Cell Tissue Type: HEK293T cells
LAG-3/CD223 Antibody Western Blot validation (1:1000 overnight dilution) in HEK293T cells (Cat no:16616-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...