Tested Applications
| Positive WB detected in | THP-1 cells, HL-60 cells, TF-1 cells |
| Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue |
| Positive IF/ICC detected in | THP-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67220-1-Ig targets LAIR1 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14459 Product name: Recombinant human LAIR1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 184-287 aa of BC027899 Sequence: FCLHRQNQIKQGPPRSKDEEQKPQQRPDLAVDVLERTADKATVNGLPEKDRETDTSALAAGSSQEVTYAQLDHWALTQRTARAVSPQSTKPMAESITYAAVARH Predict reactive species |
| Full Name | leukocyte-associated immunoglobulin-like receptor 1 |
| Calculated Molecular Weight | 287 aa, 31 kDa |
| Observed Molecular Weight | 40-50 kDa |
| GenBank Accession Number | BC027899 |
| Gene Symbol | LAIR1 |
| Gene ID (NCBI) | 3903 |
| RRID | AB_2882511 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q6GTX8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Leukocyte-associated immunoglobulin-like receptor 1 (LAIR1) is a transmembrane glycoprotein with a single immunoglobulin-like domain and a cytoplasmic tail containing two immune receptor tyrosine-based inhibitory motifs (PMID: 9285412). LAIR1 is expressed on the majority of human PBMCs, including NK, T, B, monocytes, and dendritic cells, as well as the majority of thymocytes (PMID: 10229813). It functions as an inhibitory receptor that plays a constitutive negative regulatory role on cytolytic function of NK cells, B cells and T cells. LAIR1 is a collagen receptor (PMID: 16754721). Tumor-expressed collagens can modulate immune cell function through the inhibitory collagen receptor LAIR1 (PMID: 21955987).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for LAIR1 antibody 67220-1-Ig | Download protocol |
| IHC protocol for LAIR1 antibody 67220-1-Ig | Download protocol |
| WB protocol for LAIR1 antibody 67220-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The LAIR1 Monoclonal antibody (1A5D1), catalog number 67220-1-Ig, has 1 total citation. It appears in the journal Cancer Medicine (2022), in a study developing and validating a leukocyte-associated immunoglobulin-like receptor-1 prognostic signature for lower-grade gliomas. The associated research field is oncology/neuro-oncology, specifically glioma prognosis and immune receptor biology. The antibody was applied in WB, IHC, and IF using human samples.
| Species | Application | Title |
|---|---|---|
Cancer Med Development and validation of a leukocyte-associated immunoglobulin-like receptor-1 prognostic signature for lower-grade gliomas. |
Reviews
What customers say
The single review for this product is a 5-star rating. The user reported using the antibody for immunofluorescence at a 1:200 dilution on breast cancer tissue and stated that it worked very well. Overall, the feedback is positive, indicating reliable performance in IF applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Haritha (Verified Customer) (12-23-2025) | The antibody worked very well.
|
