Tested Applications
Positive WB detected in | THP-1 cells, HL-60 cells, TF-1 cells |
Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | human tonsillitis tissue |
Positive IF/ICC detected in | THP-1 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:1000-1:4000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IHC | See 1 publications below |
IF | See 1 publications below |
Product Information
67220-1-Ig targets LAIR1 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14459 Product name: Recombinant human LAIR1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 184-287 aa of BC027899 Sequence: FCLHRQNQIKQGPPRSKDEEQKPQQRPDLAVDVLERTADKATVNGLPEKDRETDTSALAAGSSQEVTYAQLDHWALTQRTARAVSPQSTKPMAESITYAAVARH Predict reactive species |
Full Name | leukocyte-associated immunoglobulin-like receptor 1 |
Calculated Molecular Weight | 287 aa, 31 kDa |
Observed Molecular Weight | 40-50 kDa |
GenBank Accession Number | BC027899 |
Gene Symbol | LAIR1 |
Gene ID (NCBI) | 3903 |
RRID | AB_2882511 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q6GTX8 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Leukocyte-associated immunoglobulin-like receptor 1 (LAIR1) is a transmembrane glycoprotein with a single immunoglobulin-like domain and a cytoplasmic tail containing two immune receptor tyrosine-based inhibitory motifs (PMID: 9285412). LAIR1 is expressed on the majority of human PBMCs, including NK, T, B, monocytes, and dendritic cells, as well as the majority of thymocytes (PMID: 10229813). It functions as an inhibitory receptor that plays a constitutive negative regulatory role on cytolytic function of NK cells, B cells and T cells. LAIR1 is a collagen receptor (PMID: 16754721). Tumor-expressed collagens can modulate immune cell function through the inhibitory collagen receptor LAIR1 (PMID: 21955987).
Protocols
Product Specific Protocols | |
---|---|
IF protocol for LAIR1 antibody 67220-1-Ig | Download protocol |
IHC protocol for LAIR1 antibody 67220-1-Ig | Download protocol |
WB protocol for LAIR1 antibody 67220-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |