Tested Applications
| Positive WB detected in | THP-1 cells, HL-60 cells, TF-1 cells |
| Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue |
| Positive IF/ICC detected in | THP-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
67220-1-Ig targets LAIR1 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14459 Product name: Recombinant human LAIR1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 184-287 aa of BC027899 Sequence: FCLHRQNQIKQGPPRSKDEEQKPQQRPDLAVDVLERTADKATVNGLPEKDRETDTSALAAGSSQEVTYAQLDHWALTQRTARAVSPQSTKPMAESITYAAVARH Predict reactive species |
| Full Name | leukocyte-associated immunoglobulin-like receptor 1 |
| Calculated Molecular Weight | 287 aa, 31 kDa |
| Observed Molecular Weight | 40-50 kDa |
| GenBank Accession Number | BC027899 |
| Gene Symbol | LAIR1 |
| Gene ID (NCBI) | 3903 |
| RRID | AB_2882511 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q6GTX8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Leukocyte-associated immunoglobulin-like receptor 1 (LAIR1) is a transmembrane glycoprotein with a single immunoglobulin-like domain and a cytoplasmic tail containing two immune receptor tyrosine-based inhibitory motifs (PMID: 9285412). LAIR1 is expressed on the majority of human PBMCs, including NK, T, B, monocytes, and dendritic cells, as well as the majority of thymocytes (PMID: 10229813). It functions as an inhibitory receptor that plays a constitutive negative regulatory role on cytolytic function of NK cells, B cells and T cells. LAIR1 is a collagen receptor (PMID: 16754721). Tumor-expressed collagens can modulate immune cell function through the inhibitory collagen receptor LAIR1 (PMID: 21955987).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for LAIR1 antibody 67220-1-Ig | Download protocol |
| IHC protocol for LAIR1 antibody 67220-1-Ig | Download protocol |
| WB protocol for LAIR1 antibody 67220-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Haritha (Verified Customer) (12-23-2025) | The antibody worked very well.
|

















