LAMA4 (Isoform 3) Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LAMA4 (Isoform 3) Polyclonal antibody, PBS Only (10465-1-PBS)

• 

  WB analysis of human heart using 10465-1-AP (same clone as 10465-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 10465-1-AP (LAMA4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10465-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human skeletal muscle using 10465-1-AP (same clone as 10465-1-PBS)

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 10465-1-AP (LAMA4 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10465-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary using 10465-1-AP (same clone as 10465-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary using 10465-1-AP (LAMA4 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 10465-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary using 10465-1-AP (same clone as 10465-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary using 10465-1-AP (LAMA4 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 10465-1-PBS in a different storage buffer formulation.

LAMA4 (Isoform 3) Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 10465-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

10465-1-PBS targets LAMA4 (Isoform 3) in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0736

  Product name: Recombinant human LAMA4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-120 aa of BC004241

  Sequence: MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPETSEPRVALGRLPPAAEVQCPCHCHPAGAPAPPRAVPHSSFSLSPPLSSPQCLESFTWARSVRKLEIKSFPL

• Full Name: laminin, alpha 4
• Calculated Molecular Weight: 13 kDa
• Observed Molecular Weight: 11-13 kDa
• GenBank Accession Number: BC004241
• Gene Symbol: Laminin alpha 4/LAMA4
• Gene ID (NCBI): 3910
• RRID: AB_2234461
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16363
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Laminin is a basement membrane glycoprotein composed of three nonidentical chains, A, B1, and B2 (PMID: 7959779). LAMA4 (laminin, alpha 4), an A chain variant, is a subunit of laminin-8 (laminin-411), laminin-9 (laminin-421) and laminin-14 (laminin-423) (PMID: 10842354; 10964957). LAMA4 is widely distributed in developing and adult human tissues, and mainly localized to mesenchyme-derived tissues (PMID: 12133914). It may have a role in formation and function of endothelium, transmigration of inflammatory cells through endothelium, and invasion of certain tumors (PMID: 17533363). Three alternatively spliced mRNAs give rise to three isoforms. This antibody was generated against the full length (1-120aa) of isoform 3.