LAP3 Monoclonal antibody, PBS Only

• 

  WB analysis of NIH/3T3 using 66417-1-Ig (same clone as 66417-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66417-1-Ig (LAP3 Antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66417-1-PBS in a different storage buffer formulation.

• 

  WB analysis of C2C12 using 66417-1-Ig (same clone as 66417-1-PBS)

  C2C12 cell were subjected to SDS PAGE followed by western blot with 66417-1-Ig (LAP3 Antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66417-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66417-1-Ig (same clone as 66417-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66417-1-Ig (LAP3 Antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66417-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 66417-1-Ig (same clone as 66417-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 66417-1-Ig (LAP3 Antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66417-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 66417-1-Ig (same clone as 66417-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 66417-1-Ig (LAP3 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66417-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 66417-1-Ig (same clone as 66417-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 66417-1-Ig (LAP3 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66417-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66417-1-Ig (same clone as 66417-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using LAP3 antibody (66417-1-Ig, Clone: 1B11B8 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66417-1-PBS in a different storage buffer formulation.

LAP3 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66417-1-PBS

Clone No.1B11B8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Cytosol aminopeptidase, LAP, LAP 3, LAP3, LAPEP, leucine aminopeptidase 3, Leucyl aminopeptidase, PEPS, Peptidase S, Proline aminopeptidase, Prolyl aminopeptidase

---

Product Information

66417-1-PBS targets LAP3 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6300

  Product name: Recombinant human LAP3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 271-519 aa of BC065564

  Sequence: NANEPPLVFVGKGITFDSGGISIKASANMDLMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKANKPGDVVRAKNGKTIQVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMTGRPTRTLIEFLLRFSQDNA

• Full Name: leucine aminopeptidase 3
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC065564
• Gene Symbol: LAP3
• Gene ID (NCBI): 51056
• RRID: AB_2881789
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P28838
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LAP3(Leucine aminopeptidase 3) is also named as LAPEP, PEPS(peptidase S) and belongs to the peptidase M17 family. It can catalyzes the removal of unsubstituted N-terminal amino-acids from various peptides and be presumably involved in the processing end regular turnover of intracellular proteins. PEPS is found in a wide variety of tissues and cultured cells but not in red cells and skin. The enzyme can utilize several di-, tri-, and tetrapeptides as substrates and is the slowest migrating of the peptidases after electrophoresis.(PMID:689684). LAP3 has two isoform with MW of 52 and 56 kDa.