LAP3 Monoclonal antibody

LAP3 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 66417-1-Ig
Clone No.1B11B8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, ELISA

Cytosol aminopeptidase, LAP, LAP 3, LAP3, LAPEP, leucine aminopeptidase 3, Leucyl aminopeptidase, PEPS, Peptidase S, Proline aminopeptidase, Prolyl aminopeptidase

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inNIH/3T3 cells, C2C12 cell, HeLa cells, HepG2 cells
Positive IHC detected inhuman lung tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:100-1:400
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66417-1-Ig targets LAP3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6300

Product name: Recombinant human LAP3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 271-519 aa of BC065564

Sequence: NANEPPLVFVGKGITFDSGGISIKASANMDLMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKANKPGDVVRAKNGKTIQVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMTGRPTRTLIEFLLRFSQDNA

Predict reactive species
Full Name leucine aminopeptidase 3
Calculated Molecular Weight 56 kDa
Observed Molecular Weight 56 kDa
GenBank Accession NumberBC065564
Gene Symbol LAP3
Gene ID (NCBI) 51056
RRIDAB_2881789
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP28838
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LAP3(Leucine aminopeptidase 3) is also named as LAPEP, PEPS(peptidase S) and belongs to the peptidase M17 family. It can catalyzes the removal of unsubstituted N-terminal amino-acids from various peptides and be presumably involved in the processing end regular turnover of intracellular proteins. PEPS is found in a wide variety of tissues and cultured cells but not in red cells and skin. The enzyme can utilize several di-, tri-, and tetrapeptides as substrates and is the slowest migrating of the peptidases after electrophoresis.(PMID:689684). LAP3 has two isoform with MW of 52 and 56 kDa.

Protocols

Product Specific Protocols
WB protocol for LAP3 antibody 66417-1-IgDownload protocol
IHC protocol for LAP3 antibody 66417-1-IgDownload protocol
IF protocol for LAP3 antibody 66417-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...