LARS Monoclonal antibody

• 

  WB analysis using 67940-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67940-1-Ig (LARS antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with Lamin B1 Monoclonal antibody (66095-1-Ig) as loading control.

• 

  WB analysis using 67940-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67940-1-Ig (LARS antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 67940-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using LARS antibody (67940-1-Ig, Clone: 1E8D4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

LARS Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67940-1-Ig

Clone No.1E8D4

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

FLJ10595, FLJ21788, hr025Cl, HSPC192, KIAA1352, LARS, LARS1, Leucine tRNA ligase, leucyl tRNA synthetase, LEURS, LEUS, LRS, PIG44, RNTLS

---

Tested Applications

• Positive WB detected in: HeLa cells, PC-12 cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, NIH/3T3 cells, 4T1 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67940-1-Ig targets LARS in WB, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15944

  Product name: Recombinant human LARS protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 827-1176 aa of BC151214

  Sequence: EFQAAKDKYRELAVEGMHRELVFRFIEVQTLLLAPFCPHLCEHIWTLLGKPDSIMNASWPVAGPVNEVLIHSSQYLMEVTHDLRLRLKNYMMPAKGKKTDKQPLQKPSHCTIYVAKNYPPWQHTTLSVLRKHFEANNGKLPDNKVIASELGSMPELKKYMKKVMPFVAMIKENLEKMGPRILDLQLEFDEKAVLMENIVYLTNSLELEHIEVKFASEAEDKIREDCCPGKPLNVFRIEPGVSVSLVNPQPSNGHFSTKIEIRQGDNCDSIIRRLMKMNRGIKDLSKVKLMRFDDPLLGPRRVPVLGKEYTEKTPISEHAVFNVDLMSKKIHLTENGIRVDIGDTIIYLVH

• Full Name: leucyl-tRNA synthetase
• Calculated Molecular Weight: 1176 aa, 134 kDa
• Observed Molecular Weight: 135-140 kDa
• GenBank Accession Number: BC151214
• Gene Symbol: LARS
• Gene ID (NCBI): 51520
• RRID: AB_2918692
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9P2J5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.