LARS Monoclonal antibody, PBS Only

• 

  WB analysis using 67940-1-Ig (same clone as 67940-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67940-1-Ig (LARS antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with Lamin B1 Monoclonal antibody (66095-1-Ig) as loading control. This data was developed using the same antibody clone with 67940-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67940-1-Ig (same clone as 67940-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67940-1-Ig (LARS antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67940-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67940-1-Ig (same clone as 67940-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using LARS antibody (67940-1-Ig, Clone: 1E8D4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67940-1-PBS in a different storage buffer formulation.

LARS Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 67940-1-PBS

Clone No.1E8D4

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

FLJ10595, FLJ21788, hr025Cl, HSPC192, KIAA1352, LARS, LARS1, Leucine tRNA ligase, leucyl tRNA synthetase, LEURS, LEUS, LRS, PIG44, RNTLS

---

Product Information

67940-1-PBS targets LARS in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15944

  Product name: Recombinant human LARS protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 827-1176 aa of BC151214

  Sequence: EFQAAKDKYRELAVEGMHRELVFRFIEVQTLLLAPFCPHLCEHIWTLLGKPDSIMNASWPVAGPVNEVLIHSSQYLMEVTHDLRLRLKNYMMPAKGKKTDKQPLQKPSHCTIYVAKNYPPWQHTTLSVLRKHFEANNGKLPDNKVIASELGSMPELKKYMKKVMPFVAMIKENLEKMGPRILDLQLEFDEKAVLMENIVYLTNSLELEHIEVKFASEAEDKIREDCCPGKPLNVFRIEPGVSVSLVNPQPSNGHFSTKIEIRQGDNCDSIIRRLMKMNRGIKDLSKVKLMRFDDPLLGPRRVPVLGKEYTEKTPISEHAVFNVDLMSKKIHLTENGIRVDIGDTIIYLVH

• Full Name: leucyl-tRNA synthetase
• Calculated Molecular Weight: 1176 aa, 134 kDa
• Observed Molecular Weight: 135-140 kDa
• GenBank Accession Number: BC151214
• Gene Symbol: LARS
• Gene ID (NCBI): 51520
• RRID: AB_2918692
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9P2J5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.