LASP1 Monoclonal antibody

• 

  WB analysis using 68080-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68080-1-Ig (LASP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 68080-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68080-1-Ig (LASP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human peripheral blood platelets using 68080-1-Ig

  human peripheral blood platelets were subjected to SDS PAGE followed by western blot with 68080-1-Ig (LASP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 68080-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 68080-1-Ig (LASP1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 68080-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 68080-1-Ig (LASP1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 68080-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 68080-1-Ig (LASP1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 68080-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 68080-1-Ig (LASP1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A549 using 68080-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using LASP1 antibody (68080-1-Ig, Clone: 1G4B6 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• Featured Product
• KD/KO Validated

LASP1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 68080-1-Ig

Clone No.1G4B6

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

1G4B6, LASP-1, LIM and SH3 protein 1, MLN50

---

Tested Applications

• Positive WB detected in: A431 cells, HCT 116 cells, human peripheral blood platelets, PC-3 cells, HeLa cells
• Positive IHC detected in: human liver cancer tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below

Product Information

68080-1-Ig targets LASP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18101

  Product name: Recombinant human LASP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 125-210 aa of BC012460

  Sequence: EFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAA

• Full Name: LIM and SH3 protein 1
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 35-38 kDa
• GenBank Accession Number: BC012460
• Gene Symbol: LASP1
• Gene ID (NCBI): 3927
• ENSEMBL Gene ID: ENSG00000002834
• RRID: AB_2918817
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q14847
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LASP1(LIM and SH3 protein 1), also known as MLN50, is a 261 amino acid protein that localizes to both the cytoplasm and the cytoskeleton(PMID: 7589475). LASP1 consists of an N-terminal LIM-domain with two zinc finger motifs, followed by two central actin-binding nebulin repeats, flanked by a linker region and a C-terminal SH3 domain (PMID: 17177073, 9848085). LASP-1 interacts with F-Actin and plays an important role in the regulation of Actin-associated cytoskeletal organization. Agonist-dependent changes in LASP1 phosphorylation may regulate Actin-related ion transport activities in epithelial cells (PMID: 15465019,12571245). Overexpression of LASP-1 is associated with breast cancer, and plays a role in tumor transformation and metastasis (PMID: 17956604).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Death Dis; TRIM15 forms a regulatory loop with the AKT/FOXO1 axis and LASP1 to modulate the sensitivity of HCC cells to TKIs; Authors - Chong Yang ; KD Validated