• Featured Product
  • KD/KO Validated

LASP1 Monoclonal antibody

LASP1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 68080-1-Ig
Clone No.1G4B6

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

1G4B6, LASP-1, LIM and SH3 protein 1, MLN50

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, HCT 116 cells, human peripheral blood platelets, PC-3 cells, HeLa cells
Positive IHC detected inhuman liver cancer tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68080-1-Ig targets LASP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag18101

Product name: Recombinant human LASP1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 125-210 aa of BC012460

Sequence: EFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAA

Predict reactive species
Full Name LIM and SH3 protein 1
Calculated Molecular Weight 30 kDa
Observed Molecular Weight35-38 kDa
GenBank Accession NumberBC012460
Gene Symbol LASP1
Gene ID (NCBI) 3927
ENSEMBL Gene IDENSG00000002834
RRIDAB_2918817
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ14847
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LASP1(LIM and SH3 protein 1), also known as MLN50, is a 261 amino acid protein that localizes to both the cytoplasm and the cytoskeleton(PMID: 7589475). LASP1 consists of an N-terminal LIM-domain with two zinc finger motifs, followed by two central actin-binding nebulin repeats, flanked by a linker region and a C-terminal SH3 domain (PMID: 17177073, 9848085). LASP-1 interacts with F-Actin and plays an important role in the regulation of Actin-associated cytoskeletal organization. Agonist-dependent changes in LASP1 phosphorylation may regulate Actin-related ion transport activities in epithelial cells (PMID: 15465019,12571245). Overexpression of LASP-1 is associated with breast cancer, and plays a role in tumor transformation and metastasis (PMID: 17956604).

Protocols

Product Specific Protocols
IF protocol for LASP1 antibody 68080-1-IgDownload protocol
IHC protocol for LASP1 antibody 68080-1-IgDownload protocol
WB protocol for LASP1 antibody 68080-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell Death Dis

TRIM15 forms a regulatory loop with the AKT/FOXO1 axis and LASP1 to modulate the sensitivity of HCC cells to TKIs

Authors - Chong Yang
  • KD Validated
Loading...
||
New chat Able
正在加载,请稍候...