Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated LASP1 Monoclonal antibody

LASP1 Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-68080
Clone No.1G4B6

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC, FC (Intra)

1G4B6, LASP-1, LIM and SH3 protein 1, MLN50

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inA549 cells
Positive FC (Intra) detected inA549 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68080 targets LASP1 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag18101

Product name: Recombinant human LASP1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 125-210 aa of BC012460

Sequence: EFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAA

Predict reactive species
Full Name LIM and SH3 protein 1
Calculated Molecular Weight 30 kDa
Observed Molecular Weight35-38 kDa
GenBank Accession NumberBC012460
Gene Symbol LASP1
Gene ID (NCBI) 3927
ENSEMBL Gene IDENSG00000002834
RRIDAB_2934619
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ14847
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

LASP1(LIM and SH3 protein 1), also known as MLN50, is a 261 amino acid protein that localizes to both the cytoplasm and the cytoskeleton(PMID: 7589475). LASP1 consists of an N-terminal LIM-domain with two zinc finger motifs, followed by two central actin-binding nebulin repeats, flanked by a linker region and a C-terminal SH3 domain (PMID: 17177073, 9848085). LASP-1 interacts with F-Actin and plays an important role in the regulation of Actin-associated cytoskeletal organization. Agonist-dependent changes in LASP1 phosphorylation may regulate Actin-related ion transport activities in epithelial cells (PMID: 15465019,12571245). Overexpression of LASP-1 is associated with breast cancer, and plays a role in tumor transformation and metastasis (PMID: 17956604).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 LASP1 antibody CL488-68080Download protocol
IF protocol for CL Plus 488 LASP1 antibody CL488-68080Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...