Tested Applications
| Positive IF/ICC detected in | A549 cells |
| Positive FC (Intra) detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-68080 targets LASP1 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18101 Product name: Recombinant human LASP1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 125-210 aa of BC012460 Sequence: EFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAA Predict reactive species |
| Full Name | LIM and SH3 protein 1 |
| Calculated Molecular Weight | 30 kDa |
| Observed Molecular Weight | 35-38 kDa |
| GenBank Accession Number | BC012460 |
| Gene Symbol | LASP1 |
| Gene ID (NCBI) | 3927 |
| ENSEMBL Gene ID | ENSG00000002834 |
| RRID | AB_2934619 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q14847 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL Plus 488 LASP1 antibody CL488-68080 | Download protocol |
| IF protocol for CL Plus 488 LASP1 antibody CL488-68080 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





