Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

LASS2 Polyclonal antibody

LASS2 Polyclonal Antibody for WB, IHC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Ceramide synthase 2, CerS2, EC:2.3.1.24, EC:2.3.1.297, Sphingosine N-acyltransferase CERS2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for LASS2 in ?

Tested Applications

Positive WB detected inmouse liver tissue, HeLa cells, rat liver tissue, HepG2 cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman liver tissue, human thyroid cancer tissue, mouse lung tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20344-1-AP targets LASS2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14151

Product name: Recombinant human LASS2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 315-380 aa of BC010032

Sequence: LHIFWAYLILRMAHKFITGKLVEDERSDREETESSEGEEAAAGGGAKSRPLANGHPILNNNHRKND

Predict reactive species
Full Name LAG1 homolog, ceramide synthase 2
Calculated Molecular Weight 380 aa, 45 kDa
Observed Molecular Weight 45 kDa, 37 kDa
GenBank Accession NumberBC010032
Gene Symbol LASS2
Gene ID (NCBI) 29956
RRIDAB_2878677
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96G23
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LASS2, also known as TMSG1, is a novel suppressor of human cancer metastasis. As one member of LASS family, including LASS1-6, LASS2 mRNA is at the highest level of all LASS members, and has the broadest tissue distribution, particularly abundant in the liver, kidney and brain in mice. The biological roles of LASS2 include protection from aging , hepatic INS resistance, and hepatocellular carcinoma (HCC) progression. LASS2 has been correlated with the degree of invasion and recurrence of carcinomas of the prostate, liver, breast and bladder.

Protocols

Product Specific Protocols
IHC protocol for LASS2 antibody 20344-1-APDownload protocol
IP protocol for LASS2 antibody 20344-1-APDownload protocol
WB protocol for LASS2 antibody 20344-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The LASS2 Polyclonal antibody (Cat# 20344-1-AP) has 10 citations published in journals including Cardiovascular Research, Food Research International, Phytotherapy Research, Molecular Carcinogenesis, Experimental Cell Research, Journal of Cancer, Toxicological Mechanisms and Methods, Tumor Biology, and Free Radical Biology and Medicine. The associated research fields span cardiovascular disease (heart failure, cardiac fibrosis), lipid metabolism, cancer biology (bladder cancer, glioma, renal carcinoma), neurodegeneration (Parkinson's disease), and sphingolipid signaling.

SpeciesApplicationTitle
mouseWB

Cardiovasc Res

Nogo-A reduces ceramide de novo biosynthesis to protect from heart failure.

Authors - Linda Sasset
  • KD Validated
mouseWB

Food Res Int

Influence of fatty acid distribution on lipid metabolism and cognitive development in first-weaned mice

Authors - Xinggang Ni
mouseWB

Phytother Res

Bioactive Sphingolipids of Cordyceps sinensis Modulate Tumor Immunity Through the SphK1-Mediated Cer/S1P Axis.

Authors - Qi-Xuan Kuang
humanWB

Exp Cell Res

MicroRNA-98 promotes drug resistance and regulates mitochondrial dynamics by targeting LASS2 in bladder cancer cells.

Authors - Ting Luan
  • KD Validated
WB,IHC

Mol Carcinog

The Contradictory Effects of SPTLC1 on Clear Cell Renal Carcinoma Sensitivity to Sunitinib Mediated by Androgen Receptor

Authors - Liqiong Liao
humanWB,IF

J Cancer

LASS2 regulates invasion and chemoresistance via ERK/Drp1 modulated mitochondrial dynamics in bladder cancer cells.

Authors - Lijuan Huang
  • KD Validated
Loading...
||
New chat

Able™

正在加载,请稍候...