Tested Applications
| Positive WB detected in | mouse liver tissue, HeLa cells, rat liver tissue, HepG2 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human liver tissue, human thyroid cancer tissue, mouse lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 4 publications below |
| WB | See 8 publications below |
| IHC | See 2 publications below |
| IF | See 2 publications below |
Product Information
20344-1-AP targets LASS2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14151 Product name: Recombinant human LASS2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 315-380 aa of BC010032 Sequence: LHIFWAYLILRMAHKFITGKLVEDERSDREETESSEGEEAAAGGGAKSRPLANGHPILNNNHRKND Predict reactive species |
| Full Name | LAG1 homolog, ceramide synthase 2 |
| Calculated Molecular Weight | 380 aa, 45 kDa |
| Observed Molecular Weight | 45 kDa, 37 kDa |
| GenBank Accession Number | BC010032 |
| Gene Symbol | LASS2 |
| Gene ID (NCBI) | 29956 |
| RRID | AB_2878677 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96G23 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LASS2, also known as TMSG1, is a novel suppressor of human cancer metastasis. As one member of LASS family, including LASS1-6, LASS2 mRNA is at the highest level of all LASS members, and has the broadest tissue distribution, particularly abundant in the liver, kidney and brain in mice. The biological roles of LASS2 include protection from aging , hepatic INS resistance, and hepatocellular carcinoma (HCC) progression. LASS2 has been correlated with the degree of invasion and recurrence of carcinomas of the prostate, liver, breast and bladder.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for LASS2 antibody 20344-1-AP | Download protocol |
| IP protocol for LASS2 antibody 20344-1-AP | Download protocol |
| WB protocol for LASS2 antibody 20344-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cardiovasc Res Nogo-A reduces ceramide de novo biosynthesis to protect from heart failure.
| ||
J Cancer LASS2 impairs proliferation of glioma stem cells and migration and invasion of glioma cells mainly via inhibition of EMT and apoptosis promotion.
| ||
Exp Cell Res MicroRNA-98 promotes drug resistance and regulates mitochondrial dynamics by targeting LASS2 in bladder cancer cells.
| ||
Toxicol Mech Methods Chronic ethanol exposure induces cardiac fibroblast transdifferentiation via ceramide accumulation and oxidative stress | ||
J Cancer LASS2 regulates invasion and chemoresistance via ERK/Drp1 modulated mitochondrial dynamics in bladder cancer cells.
| ||
Tumour Biol miR-9 promotes cell proliferation and inhibits apoptosis by targeting LASS2 in bladder cancer. |

















