Tested Applications
Positive WB detected in | A375 cells, mouse skin tissue, rat skin tissue |
Positive IHC detected in | human skin tissue, human oesophagus tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | A375 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
21771-1-AP targets LCE1B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag16442 Product name: Recombinant human LCE1B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC104232 Sequence: MSCQQNQQQCQPPPKCIPKCPPKCLTPRCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGSCGSSSGGCCSSGGGGCCLSHHRRRRSHCHRPQSSGCCSQPSGGSSCCGGGSGQHSGGCC Predict reactive species |
Full Name | late cornified envelope 1B |
Calculated Molecular Weight | 118 aa, 12 kDa |
Observed Molecular Weight | 10-12 kDa |
GenBank Accession Number | BC104232 |
Gene Symbol | LCE1B |
Gene ID (NCBI) | 353132 |
RRID | AB_10858482 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q5T7P3 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Human LCE1B (Late cornified envelope protein 1B), also named late envelope protein 2 (LEP2), is located at human Chromosome1q21 which contains multiple LCE clusters. LCE1B gene is predicated to encode a 118-aa protein, and is currently evidenced at transcript level. Its expression was skin-specific and was readily detected in adult trunk skin, adult arm skin, fetal skin, penal skin, vulva, esophagus and tongue (PMID: 15854049). LCE genes respond to environmental stimuli such as calcium levels and ultraviolet (UV) light, however, LCE groups have distinct functions (PMID: 15854049).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for LCE1B antibody 21771-1-AP | Download protocol |
IHC protocol for LCE1B antibody 21771-1-AP | Download protocol |
IF protocol for LCE1B antibody 21771-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |