LDHA Polyclonal antibody

• Home
• Products
• Primary Antibodies
• LDHA Polyclonal antibody (21799-1-AP)

• Featured Product
• KD/KO Validated

LDHA Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 21799-1-AP Copied!

Publications (136)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

Cell proliferation-inducing gene 19 protein, EC:1.1.1.27, lactate dehydrogenase A, LDH A, LDH-A

• 

  WB analysis using 21799-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21799-1-AP (LDHA antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MDA-MB-231 using 21799-1-AP

  WB result of LDHA antibody (21799-1-AP; 1:10000; room temperature for 1.5 hours) with wild-type and LDHA knockout MDA-MB-231 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 21799-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 21799-1-AP (LDHA antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 21799-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 21799-1-AP (LDHA antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 21799-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 21799-1-AP (LDHA antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human testis using 21799-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 21799-1-AP (LDHA antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A375 using 21799-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 21799-1-AP (LDHA antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 21799-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 21799-1-AP (LDHA antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HEK-293 using 21799-1-AP

  IP result of anti-LDHA (IP:21799-1-AP, 4ug; Detection:21799-1-AP 1:500) with HEK-293 cells lysate 2000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skeletal muscle using 21799-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle using 21799-1-AP (LDHA antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skeletal muscle using 21799-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle using 21799-1-AP (LDHA antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 21799-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HepG2 cells using LDHA antibody (21799-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 21799-1-AP

  Immunofluorescent analysis of HepG2 cells, using LDHA antibody 21799-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HepG2 using 21799-1-AP

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug LDHA Polyclonal antibody (21799-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for LDHA in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, MCF-7 cells, human testis tissue, A375 cells, HepG2 cells, NIH/3T3 cells, MDA-MB-231 cells, mouse kidney tissue, rat kidney tissue
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:30000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21799-1-AP targets LDHA in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16703

  Product name: Recombinant human LDHA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 283-332 aa of BC067223

  Sequence: IKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF

• Full Name: lactate dehydrogenase A
• Calculated Molecular Weight: 332 aa, 37 kDa
• Observed Molecular Weight: 32-37 kDa
• GenBank Accession Number: BC067223
• Gene Symbol: LDHA
• Gene ID (NCBI): 3939
• RRID: AB_10858925
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P00338
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Lactate dehydrogenase (LDH) is composed of A subunits predominate in skeletal muscle and B subunits are abundantly produced in brain and heart. The LDHA (lactate dehydrogenase A) and COPB1 (coatomer protein complex, subunit beta 1)genes, are involved in energy metabolism and protein transport processes. Both genes might play important roles in muscle development. It has some isoforms with the molecular mass of 27-40 kDa and can form a homotetramer(PMID:11276087).

Publications

What published studies show

The LDHA Polyclonal antibody (catalog number 21799-1-AP) has 136 citations. These appear in journals including Cell, Nature Metabolism, Molecular Cell, Cell Death & Differentiation, EMBO Reports, Oncogene, Nature Communications, and Science Advances, among others. Research fields span glycolysis and lactate metabolism, the Warburg effect, histone lactylation, ferroptosis, and cancer biology (hepatocellular, gastric, colorectal, pancreatic, and breast cancers), as well as neurodegeneration, inflammation, and metabolic reprogramming. Applications are primarily Western blot, immunohistochemistry, and immunofluorescence.

Automatically generated from the 136 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell; A tissue injury sensing and repair pathway distinct from host pathogen defense; Authors - Siqi Liu
mouse,human	WB	Cell Metab; Astrocytic LRP1 enables mitochondria transfer to neurons and mitigates brain ischemic stroke by suppressing ARF1 lactylation; Authors - Jian Zhou
mouse	WB	Adv Mater; Functionalized Nanozyme Microcapsules Targeting Deafness Prevention via Mitochondrial Homeostasis Remodeling; Authors - Shengjie Ge
human	WB,IF	Cancer Commun (Lond); Simvastatin overcomes the pPCK1-pLDHA-SPRINGlac axis-mediated ferroptosis and chemo-immunotherapy resistance in AKT-hyperactivated intrahepatic cholangiocarcinoma; Authors - Jinghan Zhu
mouse	IF	Nat Metab; Time of exercise differentially impacts bone growth in mice; Authors - Shaoling Yu
		Cancer Res; HBXIP and LSD1 Scaffolded by lncRNA Hotair Mediate Transcriptional Activation by c-Myc.; Authors - Yinghui Li

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

The single review for this antibody reports excellent performance in Western Blot on PBMCs. The user found it worked perfectly at a 1:1000 dilution and recommended an overnight incubation at 4°C. The product received a 5-star rating, reflecting strong satisfaction with its reliability and ease of use in their workflow.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Manfred (Verified Customer) (05-30-2022)

This antibody worked perfectly at 1:1000 dilution. I preferred to do overnight incubation at 4 degrees.

• Applications: Western Blot
• Cell Tissue Type: PBMCs