• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated LDHA Polyclonal antibody

LDHA Polyclonal Antibody for IF/ICC
Cat No. CL488-21799

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

lactate dehydrogenase A, LDH A, LDH M, LDH muscle subunit, LDH1, LDHA, PIG19

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-21799 targets LDHA in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16703

Product name: Recombinant human LDHA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 283-332 aa of BC067223

Sequence: IKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF

Predict reactive species
Full Name lactate dehydrogenase A
Calculated Molecular Weight 332 aa, 37 kDa
Observed Molecular Weight 32-37 kDa
GenBank Accession NumberBC067223
Gene Symbol LDHA
Gene ID (NCBI) 3939
RRIDAB_3084056
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP00338
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Lactate dehydrogenase (LDH) is composed of A subunits predominate in skeletal muscle and B subunits are abundantly produced in brain and heart. The LDHA (lactate dehydrogenase A) and COPB1 (coatomer protein complex, subunit beta 1)genes, are involved in energy metabolism and protein transport processes. Both genes might play important roles in muscle development. It has some isoforms with the molecular mass of 27-40 kDa and can form a homotetramer(PMID:11276087).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 LDHA antibody CL488-21799Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...