Product Information
84072-5-PBS targets Leptin in IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg0834 Product name: Recombinant Human Leptin protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: N-6*His Domain: 22-167 aa of BC060830 Sequence: VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC Predict reactive species |
| Full Name | leptin |
| Calculated Molecular Weight | 167 aa, 19 kDa |
| GenBank Accession Number | BC060830 |
| Gene Symbol | Leptin |
| Gene ID (NCBI) | 3952 |
| RRID | AB_3671642 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | P41159 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Leptin is a product of the obese (ob) gene and, following synthesis and secretion from fat cells in white adipose tissue, binds to and activates its cognate receptor, the leptin receptor (LEP-R) (PMID: 34084149). Still, smaller quantities have been detected in other body tissues, including the brown adipose tissue (BAT), placenta, fetal tissue, stomach, muscles, bone marrow, teeth, and brain (PMID:7568067, PMID: 12086939). Leptin circulates in the blood in both free and protein-bound forms, where the free form of leptin is the biologically active form (PMID: 12086939). Leptin can enter the central nervous system (CNS) (in the area of the choroid plexus) by receptor-mediated transport (PMID: 29254602). Leptin secretion is higher in subcutaneous than in visceral adipose tissue (PMID: 11133069, PMID: 14726444).







