Tested Applications
| Positive WB detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 2 publications below |
Product Information
21516-1-AP targets LHX6 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16047 Product name: Recombinant human LHX6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 276-363 aa of BC103937 Sequence: KHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY Predict reactive species |
| Full Name | LIM homeobox 6 |
| Calculated Molecular Weight | 392 aa, 43 kDa |
| Observed Molecular Weight | 38-40 kDa |
| GenBank Accession Number | BC103937 |
| Gene Symbol | LHX6 |
| Gene ID (NCBI) | 26468 |
| RRID | AB_2878875 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UPM6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LHX6 is a LIM homeodomain protein similar in structure to ISL-1. LHX6, like ISL-1, contains tandem LIM domains and a homeodomain that regulate its activity both in cis and through interaction with cell-specific factors. LHX6 is highly expressed in the neural crest-derived mesenchyme throughout odontogenesis and down-regulated after birth. However, LHX6 is also expressed in the palate, oral, and dental epithelium during craniofacial development. LHX6 regulates the migration and specification of neuron subtypes and marks specific neurons. The molecular weight of Endogenous LHX6 is 40 kDa, but the LHX6-PITX2 protein complex is 56 kDa (PMID: 23229549).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for LHX6 antibody 21516-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Ther Nucleic Acids Placental trophoblast cell-derived exosomal microRNA-1290 promotes the interaction between endometrium and embryo by targeting LHX6.
| ||
Exp Cell Res Hypoxia-induced exosomes promote hepatocellular carcinoma proliferation and metastasis via miR-1273f transfer. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Reyes (Verified Customer) (07-29-2024) | LHX6 (in green) appears to work nicely marking some of my neurons (in red) in human brain FFPE tissue.
![]() |


