Anti-Mouse LIGHT/CD258 Rabbit Recombinant Antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Mouse LIGHT/CD258 Rabbit Recombinant Antibody, PBS Only (98627-1-PBS)

• 

  FC experiment of mouse splenocytes using 98627-1-RR (same clone as 98627-1-PBS)

  1x10^6 untreated or anti-CD3/CD28 treated mouse splenocytes were surface stained with 0.25 ug Anti-Mouse LIGHT/CD258 Rabbit RecAb (98627-1-RR, Clone: 250481H2) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were then stained with CoraLite® Plus 405 Anti-Mouse CD8a. Cells were not fixed. This data was developed using the same antibody clone with 98627-1-PBS in a different storage buffer formulation.

• 

  FC experiment of mouse splenocytes using 98627-1-RR (same clone as 98627-1-PBS)

  1x10^6 anti-CD3/CD28 treated mouse splenocytes were surface stained with 0.25 ug Anti-Mouse LIGHT/CD258 Rabbit RecAb (98627-1-RR, Clone: 250481H2) (red) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). 1x10^6 untreated mouse splenocytes were surface stained with 0.25 ug Anti-Mouse LIGHT/CD258 Rabbit RecAb (98627-1-RR, Clone:250481H2)(black, dashed) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98627-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 98627-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98627-1-RR against Mouse LIGHT/CD258 were performed. The affinity constant is 0.700 nM.

LIGHT/CD258 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98627-1-PBS

Clone No.250481H2

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

CD258, Light, Tnfsf14, Tumor necrosis factor ligand superfamily member 14, Tumor necrosis factor ligand superfamily member 14, membrane form

---

Product Information

98627-1-PBS targets LIGHT/CD258 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2654

  Product name: Recombinant Mouse LIGHT/CD258 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 72-239 aa of NM_019418.3

  Sequence: DGGKGSWEKLIQDQRSHQANPAAHLTGANASLIGIGGPLLWETRLGLAFLRGLTYHDGALVTMEPGYYYVYSKVQLSGVGCPQGLANGLPITHGLYKRTSRYPKELELLVSRRSPCGRANSSRVWWDSSFLGGVVHLEAGEEVVVRVPGNRLVRPRDGTRSYFGAFMV

• Full Name: tumor necrosis factor (ligand) superfamily, member 14
• Calculated Molecular Weight: 26 kDa
• GenBank Accession Number: NM_019418.3
• Gene Symbol: Tnfsf14
• Gene ID (NCBI): 50930
• RRID: AB_3746226
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9QYH9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LIGHT, also known as TNFSF14, HVEML, or CD258, is a type II transmembrane protein that belongs to the TNF superfamily (PMID: 9462508). It is predominantly expressed in lymphoid tissues and produced by activated T cells and immature dendritic cells (DCs) (PMID: 9462508; 10754304). Through its two primary functional receptors HVEM (TNFRSF14) and lymphotoxin β receptor (LTβR), LIGHT signaling is involved in development and maintenance of lymphoid tissues, as well as innate and adaptive immune responses (PMID: 24575096; 26720335). In addition to the membrane form, LIGHT can also exist as a soluble form generated by cleavage of the extracellular portion of the membrane form.