• Zero Fc receptor binding
  • Site-specific conjugation
  • One universal isotype

FcZero-rAb® CoraLite® Plus 488 Anti-Human LILRA5/CD85f Rabbit Recombinant Antibody

LILRA5/CD85f FcZero-rAb® Recombinant Antibody for FC

Cat No. CL488-FcA98477
Clone No.250298G11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

LILRA5, CD85, CD85 antigen-like family member F, CD85f, ILT 11

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inhuman PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 5 ul per 10^6 cells in a 100 µl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-FcA98477 targets LILRA5/CD85f in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2737

Product name: Recombinant Human LILRA5/CD85f protein (rFc Tag) (HPLC verified)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 42-268 aa of NM_021250.4

Sequence: GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR

Predict reactive species
Full Name leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5
Calculated Molecular Weight33 kDa
GenBank Accession NumberNM_021250.4
Gene Symbol LILRA5
Gene ID (NCBI) 353514
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDA6NI73-1
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

LILRA5, also named as CD85f, ILT11, LILRB7 or LIR9, is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is a group of immune inhibitory and stimulatory receptors (PMID: 15304001). There are two membrane-bound and two soluble forms of LILRA5. The transmembrane LILRA5 contains a short cytoplasmic domain and a charged arginine residue within the transmembrane region (PMID: 19009525). It is mostly expressed in myeloid cells, including monocytes and neutrophils (PMID: 12393390). LILRA5 may play a role in triggering innate immune responses. It does not function in class I MHC antigens recognition (PMID: 16675463).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 LILRA5/CD85f antibody CL488-FcA98477Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...