CD85j / LILRB1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CD85j / LILRB1 Polyclonal antibody (26455-1-AP)

CD85j / LILRB1 Polyclonal Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 26455-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, FC (Intra), ELISA

Synonyms

LILRB1, CD85, CD85 antigen-like family member J, CD85j, FLJ37515

• 

  WB analysis using 26455-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26455-1-AP (LILRB1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Ramos using 26455-1-AP

  Ramos cells were subjected to SDS PAGE followed by western blot with 26455-1-AP (LILRB1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 26455-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 26455-1-AP (LILRB1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 26455-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 26455-1-AP (CD85j / LILRB1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 26455-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 26455-1-AP (LILRB1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 26455-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 26455-1-AP (LILRB1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 26455-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 26455-1-AP (LILRB1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of Ramos using 26455-1-AP

  1x10^6 Ramos cells were intracellularly stained with 0.25 ug CD85j / LILRB1 Polyclonal antibody (26455-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CD85j / LILRB1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Daudi cells, Ramos cells
• Positive IHC detected in: human liver tissue, human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: Ramos cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26455-1-AP targets CD85j / LILRB1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24795

  Product name: Recombinant human LILRB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 137-241 aa of BC015731

  Sequence: SGGNVTLQCDSQVAFDGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEET

• Full Name: leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 1
• Calculated Molecular Weight: 71 kDa
• Observed Molecular Weight: 71 and 110 kDa
• GenBank Accession Number: BC015731
• Gene Symbol: LILRB1
• Gene ID (NCBI): 10859
• RRID: AB_2880518
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NHL6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LILRB1, also named as CD85j or ILT2, includes four C2 Ig domains binding HLA class I molecules in the extracellular region and a cytoplasmic domain containing four immunoreceptor tyrosine-based inhibition motifs (ITIM). LILRB1 is a surface glycoprotein detected on the surface of B cells, monocytes, dendritic cells, T cells and NK cells. The predicted MW of LILRB1 is 71 kDa and 26455-1-AP antibody recognizes the 71 and 110 kDa which might be the noncovalently linked monomer. (PMID:17601702; 15474475; 17549736; 24098421)

Publications

What published studies show

The CD85j / LILRB1 Polyclonal antibody (Cat# 26455-1-AP) has 2 citations. They appear in International Immunopharmacology (2023) and Cancer Medicine (2026). Both studies used IHC on human samples. The research fields cover ovarian cancer immunosuppressive microenvironment and immune cell infiltration, as well as LILRB1 as a prognostic biomarker correlated with immune infiltration in head-and-neck squamous cell carcinoma.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Int Immunopharmacol; LILRB1+ immune cell infiltration identifies immunosuppressive microenvironment and dismal outcomes of patients with ovarian cancer; Authors - Xiaoyu Xu
human	IHC	Cancer Med; LILRB1 Is a Prognostic-Related Biomarker Correlated With Immune Infiltration in Head-Neck Squamous Cell Carcinoma.; Authors - Shuai Chen