CD85j / LILRB1 Polyclonal antibody

• 

  WB analysis using 26455-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26455-1-AP (LILRB1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Ramos using 26455-1-AP

  Ramos cells were subjected to SDS PAGE followed by western blot with 26455-1-AP (LILRB1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 26455-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 26455-1-AP (LILRB1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 26455-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 26455-1-AP (LILRB1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 26455-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 26455-1-AP (LILRB1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 26455-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 26455-1-AP (LILRB1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CD85j / LILRB1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26455-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

LILRB1, ILT2, ILT 2, FLJ37515, CD85j

---

Tested Applications

• Positive WB detected in: Daudi cells, Ramos cells
• Positive IHC detected in: human liver tissue, human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below

Product Information

26455-1-AP targets CD85j / LILRB1 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24795

  Product name: Recombinant human LILRB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 137-241 aa of BC015731

  Sequence: SGGNVTLQCDSQVAFDGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEET

• Full Name: leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 1
• Calculated Molecular Weight: 71 kDa
• Observed Molecular Weight: 71 and 110 kDa
• GenBank Accession Number: BC015731
• Gene Symbol: LILRB1
• Gene ID (NCBI): 10859
• RRID: AB_2880518
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NHL6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LILRB1, also named as CD85j or ILT2, includes four C2 Ig domains binding HLA class I molecules in the extracellular region and a cytoplasmic domain containing four immunoreceptor tyrosine-based inhibition motifs (ITIM). LILRB1 is a surface glycoprotein detected on the surface of B cells, monocytes, dendritic cells, T cells and NK cells. The predicted MW of LILRB1 is 71 kDa and 26455-1-AP antibody recognizes the 71 and 110 kDa which might be the noncovalently linked monomer. (PMID:17601702; 15474475; 17549736; 24098421)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Int Immunopharmacol; LILRB1+ immune cell infiltration identifies immunosuppressive microenvironment and dismal outcomes of patients with ovarian cancer; Authors - Xiaoyu Xu