Tested Applications
| Positive WB detected in | Daudi cells, Ramos cells |
| Positive IHC detected in | human liver tissue, human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | Ramos cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IHC | See 2 publications below |
Product Information
26455-1-AP targets CD85j / LILRB1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24795 Product name: Recombinant human LILRB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 137-241 aa of BC015731 Sequence: SGGNVTLQCDSQVAFDGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEET Predict reactive species |
| Full Name | leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 1 |
| Calculated Molecular Weight | 71 kDa |
| Observed Molecular Weight | 71 and 110 kDa |
| GenBank Accession Number | BC015731 |
| Gene Symbol | LILRB1 |
| Gene ID (NCBI) | 10859 |
| RRID | AB_2880518 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8NHL6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LILRB1, also named as CD85j or ILT2, includes four C2 Ig domains binding HLA class I molecules in the extracellular region and a cytoplasmic domain containing four immunoreceptor tyrosine-based inhibition motifs (ITIM). LILRB1 is a surface glycoprotein detected on the surface of B cells, monocytes, dendritic cells, T cells and NK cells. The predicted MW of LILRB1 is 71 kDa and 26455-1-AP antibody recognizes the 71 and 110 kDa which might be the noncovalently linked monomer. (PMID:17601702; 15474475; 17549736; 24098421)
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CD85j / LILRB1 antibody 26455-1-AP | Download protocol |
| IHC protocol for CD85j / LILRB1 antibody 26455-1-AP | Download protocol |
| WB protocol for CD85j / LILRB1 antibody 26455-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Int Immunopharmacol LILRB1+ immune cell infiltration identifies immunosuppressive microenvironment and dismal outcomes of patients with ovarian cancer | ||
Cancer Med LILRB1 Is a Prognostic-Related Biomarker Correlated With Immune Infiltration in Head-Neck Squamous Cell Carcinoma. |















