Tested Applications
Positive WB detected in | Daudi cells, Ramos cells |
Positive IHC detected in | human liver tissue, human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
IHC | See 1 publications below |
Product Information
26455-1-AP targets CD85j / LILRB1 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24795 Product name: Recombinant human LILRB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 137-241 aa of BC015731 Sequence: SGGNVTLQCDSQVAFDGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEET Predict reactive species |
Full Name | leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 1 |
Calculated Molecular Weight | 71 kDa |
Observed Molecular Weight | 71 and 110 kDa |
GenBank Accession Number | BC015731 |
Gene Symbol | LILRB1 |
Gene ID (NCBI) | 10859 |
RRID | AB_2880518 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8NHL6 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LILRB1, also named as CD85j or ILT2, includes four C2 Ig domains binding HLA class I molecules in the extracellular region and a cytoplasmic domain containing four immunoreceptor tyrosine-based inhibition motifs (ITIM). LILRB1 is a surface glycoprotein detected on the surface of B cells, monocytes, dendritic cells, T cells and NK cells. The predicted MW of LILRB1 is 71 kDa and 26455-1-AP antibody recognizes the 71 and 110 kDa which might be the noncovalently linked monomer. (PMID:17601702; 15474475; 17549736; 24098421)
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CD85j / LILRB1 antibody 26455-1-AP | Download protocol |
IHC protocol for CD85j / LILRB1 antibody 26455-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |