CD85j / LILRB1 Polyclonal antibody

CD85j / LILRB1 Polyclonal Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 26455-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, FC (Intra), ELISA

LILRB1, CD85, CD85 antigen-like family member J, CD85j, FLJ37515

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inDaudi cells, Ramos cells
Positive IHC detected inhuman liver tissue, human tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inRamos cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IHCSee 1 publications below

Product Information

26455-1-AP targets CD85j / LILRB1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag24795

Product name: Recombinant human LILRB1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 137-241 aa of BC015731

Sequence: SGGNVTLQCDSQVAFDGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEET

Predict reactive species
Full Name leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 1
Calculated Molecular Weight 71 kDa
Observed Molecular Weight 71 and 110 kDa
GenBank Accession NumberBC015731
Gene Symbol LILRB1
Gene ID (NCBI) 10859
RRIDAB_2880518
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8NHL6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LILRB1, also named as CD85j or ILT2, includes four C2 Ig domains binding HLA class I molecules in the extracellular region and a cytoplasmic domain containing four immunoreceptor tyrosine-based inhibition motifs (ITIM). LILRB1 is a surface glycoprotein detected on the surface of B cells, monocytes, dendritic cells, T cells and NK cells. The predicted MW of LILRB1 is 71 kDa and 26455-1-AP antibody recognizes the 71 and 110 kDa which might be the noncovalently linked monomer. (PMID:17601702; 15474475; 17549736; 24098421)

Protocols

Product Specific Protocols
FC protocol for CD85j / LILRB1 antibody 26455-1-APDownload protocol
IHC protocol for CD85j / LILRB1 antibody 26455-1-APDownload protocol
WB protocol for CD85j / LILRB1 antibody 26455-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Int Immunopharmacol

LILRB1+ immune cell infiltration identifies immunosuppressive microenvironment and dismal outcomes of patients with ovarian cancer

Authors - Xiaoyu Xu
Loading...
||
New chat

Able

正在加载,请稍候...