• Zero Fc receptor binding
  • Site-specific conjugation
  • One universal isotype

FcZero-rAb™ APC Anti-Human LILRB3/CD85a Rabbit Recombinant Antibody

LILRB3/CD85a FcZero-rAbTM Recombinant Antibody for FC

Cat No. APC-FcA98237
Clone No.241894C10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

LILRB3, CD85 antigen-like family member A, CD85a, HL9, ILT5

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inhuman PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 5 ul per 10^6 cells in a 100 µl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

APC-FcA98237 targets LILRB3/CD85a in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2084

Product name: Recombinant Human LILRB3/CD85a protein (rFc Tag) (HPLC verified)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 24-443 aa of BC112198

Sequence: GPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYRLDKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVNPSHRWRFTCYYYYMNTPQVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSRSHGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSFPSEPLELMVSGHSGGSSLPPTGPPSTPGLGRYLE

Predict reactive species
Full Name leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 3
Calculated Molecular Weight 631 aa, 69 kDa
GenBank Accession NumberBC112198
Gene Symbol LILRB3
Gene ID (NCBI) 11025
Conjugate APC Fluorescent Dye
Excitation/Emission Maxima Wavelengths650 nm / 660 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO75022
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

The leukocyte immunoglobulin-like receptors (LIRs, also known as ILTs, CD85, and LILRs) comprise a family of related immunoregulatory receptors encoded within the leukocyte receptor cluster (LRC) at chromosomal region 19q13.4 (PMID: 11491530). LIRs are transmembrane proteins containing either two or four extracellular immunoglobulin domains, and have diverse functions, including the regulation of inflammation, immune tolerance, cell differentiation and nervous system plasticity (PMID: 16406677; 26040207). LILRB3, also known as ILT-5 or CD85a, belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). LILRB3 is found on the surface of a variety of cell types including monocytes/macrophages, granulocytes, NK cells and some T cells. It binds to MHC class I molecules and transduces a negative signal that inhibits stimulation of an immune response. LILRB3 has been reported as a myeloid cell checkpoint that elicits profound immunomodulation (PMID: 32870822).

Protocols

Product Specific Protocols
FC protocol for APC LILRB3/CD85a antibody APC-FcA98237Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...