LIMD1 Polyclonal antibody

LIMD1 Polyclonal Antibody for WB, IF/ICC, IP, ELISA
Cat No. 28106-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human and More (1)

Applications

WB, IF/ICC, IP, ELISA

LIM domains containing 1, LIMD1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HeLa cells
Positive IP detected inHeLa cells
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 1 publications below

Product Information

28106-1-AP targets LIMD1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with Human samples.

Tested Reactivity Human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag27974

Product name: Recombinant human LIMD1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 128-260 aa of NM_014240

Sequence: MPPQEQRSRPYLHGTRHGSQDCGSRESLATSEMSAFHQPGPCEDPSCLTHGDYYDNLSLASPKWGDKPGVSPSIGLSVGSGWPSSPGSDPPLPKPCGDHPLNHRQLSLSSSRSSEGSLGGQNSGIGGRSSEKPT

Predict reactive species
Full Name LIM domains containing 1
Calculated Molecular Weight 72 aa
Observed Molecular Weight 72 kDa
GenBank Accession NumberNM_014240
Gene Symbol LIMD1
Gene ID (NCBI) 8994
RRIDAB_2881062
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UGP4
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LIMD1 is a member of the Ajuba family of LIM domain-containing proteins, these kinds of proteins have been shown to play a role in intracellular signaling, transcriptional regulation and cellular differentiation, proliferation and migration (PMID:17174104). LIMD1 predominantly localizes to the cytoplasm especially in the E-cadherin cell-cell adhesive junction, yet also translocates to the nucleus when functions as an RB corepressor (PMID:19060205). And LIMD1 acts as a scaffolding protein to form a PHD-LIMD1-VHL axis, facilitating HIF1α ubiquitination and degradation by the proteasome (PMID:22800800). LIMD1 specifically interacts with retinoblastoma protein (pRB), inhibits E2F-mediated transcription, and suppresses the expression of the majority of genes with E2F1-responsive elements. As a tumor suppressor, LIMD1 blocks tumor growth in vitro and in vivo, and is frequently down-regulated in human lung tumors (PMID:15542589), and it also be detected in normal and breast cancer tissues. LIMD1 protein exists several phosphorylation sites, which may affect its theoretical molecular weight when tested. Proteintech's 28106-1-AP antibody was generated by 133 amino acids, it could recognize the full-length protein in applications.

Protocols

Product Specific Protocols
WB protocol for LIMD1 antibody 28106-1-APDownload protocol
IP protocol for LIMD1 antibody 28106-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

J Cell Biol

Paxillin phase separation promotes focal adhesion assembly and integrin signaling

Authors - Peigang Liang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Paul (Verified Customer) (11-24-2022)

Clear specific signal just above 70kDa

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: Different lung cell lines (A549, H1299)
Loading...
||
New chat Able
正在加载,请稍候...