CoraLite® Plus 488-conjugated LIMD1 Polyclonal antibody

LIMD1 Polyclonal Antibody for IF/ICC
Cat No. CL488-28106

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

LIM domains containing 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-28106 targets LIMD1 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag27974

Product name: Recombinant human LIMD1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 128-260 aa of NM_014240

Sequence: MPPQEQRSRPYLHGTRHGSQDCGSRESLATSEMSAFHQPGPCEDPSCLTHGDYYDNLSLASPKWGDKPGVSPSIGLSVGSGWPSSPGSDPPLPKPCGDHPLNHRQLSLSSSRSSEGSLGGQNSGIGGRSSEKPT

Predict reactive species
Full Name LIM domains containing 1
Calculated Molecular Weight 72 aa
Observed Molecular Weight 72 kDa
GenBank Accession NumberNM_014240
Gene Symbol LIMD1
Gene ID (NCBI) 8994
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UGP4
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

LIMD1 is a member of the Ajuba family of LIM domain-containing proteins, these kinds of proteins have been shown to play a role in intracellular signaling, transcriptional regulation and cellular differentiation, proliferation and migration (PMID:17174104). LIMD1 predominantly localizes to the cytoplasm especially in the E-cadherin cell-cell adhesive junction, yet also translocates to the nucleus when functions as an RB corepressor (PMID:19060205). And LIMD1 acts as a scaffolding protein to form a PHD-LIMD1-VHL axis, facilitating HIF1α ubiquitination and degradation by the proteasome (PMID:22800800). LIMD1 specifically interacts with retinoblastoma protein (pRB), inhibits E2F-mediated transcription, and suppresses the expression of the majority of genes with E2F1-responsive elements. As a tumor suppressor, LIMD1 blocks tumor growth in vitro and in vivo, and is frequently down-regulated in human lung tumors (PMID:15542589), and it also be detected in normal and breast cancer tissues. LIMD1 protein exists several phosphorylation sites, which may affect its theoretical molecular weight when tested. Proteintech's 28106-1-AP antibody was generated by 133 amino acids, it could recognize the full-length protein in applications.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 LIMD1 antibody CL488-28106Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...