LIN37 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• LIN37 Polyclonal antibody (26651-1-AP)

LIN37 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 26651-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

Protein lin-37 homolog, Protein lin 37 homolog, MSTP064, lin 37, F25965

• 

  WB analysis using 26651-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26651-1-AP (LIN37 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A549 using 26651-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using LIN37 antibody (26651-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4), CL488-phalloidin (green).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for LIN37 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, Jurkat cells
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26651-1-AP targets LIN37 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24565

  Product name: Recombinant human LIN37 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-93 aa of BC009071

  Sequence: MFPVKVKVEKSELEMAKARNQLDAVLQCLLEKSHMDRERLDEEAGKTPSDTHNKDCSIAATGKRPSARFPHQRRKKRREMDDGLAEGGPQRSN

• Full Name: lin-37 homolog (C. elegans)
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC009071
• Gene Symbol: LIN37
• Gene ID (NCBI): 55957
• RRID: AB_2880590
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96GY3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LIN37, also named as Antolefinin and MSTP064, is a component of the DREAM complex (also named LINC complex). LIN37 migrates to 37 kDa for modification.

Publications

What published studies show

The LIN37 Polyclonal antibody (Cat# 26651-1-AP) has 1 total citation. It was cited in International Journal of Oncology (IF 7.3) in a 2024 study by Zhenwei Ma et al., which investigated how transcription factor E2F4 facilitates SUMOylation to promote hepatocellular carcinoma (HCC) progression through interaction with LIN9. The research field encompasses cancer biology, specifically liver cancer, transcriptional regulation, and protein modification (SUMOylation).

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Int J Oncol; Transcription factor E2F4 facilitates SUMOylation to promote HCC progression through interaction with LIN9; Authors - Zhenwei Ma