Tested Applications
Positive WB detected in | A549 cells, Jurkat cells |
Positive IF/ICC detected in | A549 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:6000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
26651-1-AP targets LIN37 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24565 Product name: Recombinant human LIN37 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-93 aa of BC009071 Sequence: MFPVKVKVEKSELEMAKARNQLDAVLQCLLEKSHMDRERLDEEAGKTPSDTHNKDCSIAATGKRPSARFPHQRRKKRREMDDGLAEGGPQRSN Predict reactive species |
Full Name | lin-37 homolog (C. elegans) |
Observed Molecular Weight | 36 kDa |
GenBank Accession Number | BC009071 |
Gene Symbol | LIN37 |
Gene ID (NCBI) | 55957 |
RRID | AB_2880590 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q96GY3 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LIN37, also named as Antolefinin and MSTP064, is a component of the DREAM complex (also named LINC complex). LIN37 migrates to 37 kDa for modification.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for LIN37 antibody 26651-1-AP | Download protocol |
IF protocol for LIN37 antibody 26651-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |