LIN37 Polyclonal antibody

LIN37 Polyclonal Antibody for WB, IF/ICC, ELISA
Cat No. 26651-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Protein lin-37 homolog, Protein lin 37 homolog, MSTP064, lin 37, F25965

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, Jurkat cells
Positive IF/ICC detected inA549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

26651-1-AP targets LIN37 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag24565

Product name: Recombinant human LIN37 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-93 aa of BC009071

Sequence: MFPVKVKVEKSELEMAKARNQLDAVLQCLLEKSHMDRERLDEEAGKTPSDTHNKDCSIAATGKRPSARFPHQRRKKRREMDDGLAEGGPQRSN

Predict reactive species
Full Name lin-37 homolog (C. elegans)
Observed Molecular Weight 36 kDa
GenBank Accession NumberBC009071
Gene Symbol LIN37
Gene ID (NCBI) 55957
RRIDAB_2880590
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96GY3
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LIN37, also named as Antolefinin and MSTP064, is a component of the DREAM complex (also named LINC complex). LIN37 migrates to 37 kDa for modification.

Protocols

Product Specific Protocols
IF protocol for LIN37 antibody 26651-1-APDownload protocol
WB protocol for LIN37 antibody 26651-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB

Int J Oncol

Transcription factor E2F4 facilitates SUMOylation to promote HCC progression through interaction with LIN9

Authors - Zhenwei Ma
Loading...
||
New chat Able
正在加载,请稍候...