LIN37 Polyclonal antibody

• 

  WB analysis using 26651-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26651-1-AP (LIN37 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of A549 using 26651-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using LIN37 antibody (26651-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4), CL488-phalloidin (green).

LIN37 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 26651-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

Protein lin-37 homolog, Protein lin 37 homolog, MSTP064, lin 37, F25965

---

Tested Applications

• Positive WB detected in: A549 cells, Jurkat cells
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

26651-1-AP targets LIN37 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24565

  Product name: Recombinant human LIN37 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-93 aa of BC009071

  Sequence: MFPVKVKVEKSELEMAKARNQLDAVLQCLLEKSHMDRERLDEEAGKTPSDTHNKDCSIAATGKRPSARFPHQRRKKRREMDDGLAEGGPQRSN

• Full Name: lin-37 homolog (C. elegans)
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC009071
• Gene Symbol: LIN37
• Gene ID (NCBI): 55957
• RRID: AB_2880590
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96GY3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LIN37, also named as Antolefinin and MSTP064, is a component of the DREAM complex (also named LINC complex). LIN37 migrates to 37 kDa for modification.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Int J Oncol; Transcription factor E2F4 facilitates SUMOylation to promote HCC progression through interaction with LIN9; Authors - Zhenwei Ma