Tested Applications
Positive WB detected in | rat brain tissue |
Positive IP detected in | mouse brain tissue |
Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
IF | See 1 publications below |
Product Information
25150-1-AP targets LIN7A in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag18440 Product name: Recombinant human LIN7A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC118609 Sequence: MLKPSVTSAPTADMATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEFRARATA Predict reactive species |
Full Name | lin-7 homolog A (C. elegans) |
Calculated Molecular Weight | 233 aa, 26 kDa |
Observed Molecular Weight | 28-30 kDa |
GenBank Accession Number | BC118609 |
Gene Symbol | LIN7A |
Gene ID (NCBI) | 8825 |
RRID | AB_2879925 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O14910 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for LIN7A antibody 25150-1-AP | Download protocol |
IHC protocol for LIN7A antibody 25150-1-AP | Download protocol |
IP protocol for LIN7A antibody 25150-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |