LITAF Polyclonal antibody

• Home
• Products
• Primary Antibodies
• LITAF Polyclonal antibody (16797-1-AP)

• Featured Product
• KD/KO Validated

LITAF Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 16797-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

PIG7, p53-induced gene 7 protein, p53 induced gene 7 protein, LPS-induced TNF-alpha factor, LPS induced TNF alpha factor

• 

  WB analysis of HeLa using 16797-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 16797-1-AP (LITAF antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 16797-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 16797-1-AP (LITAF antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 16797-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 16797-1-AP (LITAF Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 16797-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 16797-1-AP (LITAF Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 16797-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 16797-1-AP (LITAF Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 16797-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 16797-1-AP (LITAF Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 16797-1-AP

  IP result of anti-LITAF (IP:16797-1-AP, 4ug; Detection:16797-1-AP 1:600) with HeLa cells lysate 1520ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 16797-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 16797-1-AP (LITAF antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 16797-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 16797-1-AP (LITAF antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 16797-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HepG2 cells using 16797-1-AP (LITAF antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for LITAF in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16797-1-AP targets LITAF in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10269

  Product name: Recombinant human LITAF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-119 aa of BC008309

  Sequence: MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSC

• Full Name: lipopolysaccharide-induced TNF factor
• Calculated Molecular Weight: 161 aa, 17 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC008309
• Gene Symbol: LITAF
• Gene ID (NCBI): 9516
• RRID: AB_2135710
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99732
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Lipopolysaccharide-induced TNF factor(LITAF) is a transcription factor that identified as a regulator of TNF-alpha gene expression. It may has a role in protein degradation pathways and in tumor necrosis factor alpha(TNF-alpha) gene expression. Also it may regulate the expression of the CCL2/MCP-1 chemokine through NFKB1.Defects in LITAF may be involved in extramammary Paget disease (EMPD) carcinogenesis

Publications

What published studies show

The LITAF Polyclonal antibody (catalog number 16797-1-AP) has a total of 3 citations. These appear in Nature Communications, Cell & Molecular Neurobiology, and Poultry Science. The associated research fields include pancreatic cancer liver metastasis and immunosuppressive tumor microenvironment (IHC), radiosensitivity of human glioma cells via the FoxO1 pathway (WB), and inflammation/acetylcholinesterase activity in goose fatty liver formation (WB). Applications span IHC and Western blot.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Nat Commun; Single cell transcriptomic analyses implicate an immunosuppressive tumor microenvironment in pancreatic cancer liver metastasis; Authors - Shu Zhang
human	WB	Cell Mol Neurobiol; LITAF Enhances Radiosensitivity of Human Glioma Cells via the FoxO1 Pathway.; Authors - Changlin Huang ; KD Validated
	WB	Poult Sci; PRIAM1 participates in the inhibition of inflammation and acetylcholinesterase activity in goose fatty liver formation; Authors - Ying Xue