Tested Applications
Positive WB detected in | HeLa cells, HepG2 cells |
Positive IP detected in | HeLa cells |
Positive IHC detected in | human spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 2 publications below |
IHC | See 1 publications below |
Product Information
16797-1-AP targets LITAF in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag10269 Product name: Recombinant human LITAF protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC008309 Sequence: MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSC Predict reactive species |
Full Name | lipopolysaccharide-induced TNF factor |
Calculated Molecular Weight | 161 aa, 17 kDa |
Observed Molecular Weight | 24 kDa |
GenBank Accession Number | BC008309 |
Gene Symbol | LITAF |
Gene ID (NCBI) | 9516 |
RRID | AB_2135710 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q99732 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Lipopolysaccharide-induced TNF factor(LITAF) is a transcription factor that identified as a regulator of TNF-alpha gene expression. It may has a role in protein degradation pathways and in tumor necrosis factor alpha(TNF-alpha) gene expression. Also it may regulate the expression of the CCL2/MCP-1 chemokine through NFKB1.Defects in LITAF may be involved in extramammary Paget disease (EMPD) carcinogenesis
Protocols
Product Specific Protocols | |
---|---|
WB protocol for LITAF antibody 16797-1-AP | Download protocol |
IHC protocol for LITAF antibody 16797-1-AP | Download protocol |
IF protocol for LITAF antibody 16797-1-AP | Download protocol |
IP protocol for LITAF antibody 16797-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Mol Neurobiol LITAF Enhances Radiosensitivity of Human Glioma Cells via the FoxO1 Pathway.
| ||
Nat Commun Single cell transcriptomic analyses implicate an immunosuppressive tumor microenvironment in pancreatic cancer liver metastasis | ||
Poult Sci PRIAM1 participates in the inhibition of inflammation and acetylcholinesterase activity in goose fatty liver formation |