LITAF Polyclonal antibody

• 

  WB analysis of HeLa using 16797-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 16797-1-AP (LITAF antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 16797-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 16797-1-AP (LITAF antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 16797-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 16797-1-AP (LITAF Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 16797-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 16797-1-AP (LITAF Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 16797-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 16797-1-AP (LITAF Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 16797-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 16797-1-AP (LITAF Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 16797-1-AP

  IP result of anti-LITAF (IP:16797-1-AP, 4ug; Detection:16797-1-AP 1:600) with HeLa cells lysate 1520ug.

• 

  IHC staining of human spleen using 16797-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 16797-1-AP (LITAF antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human spleen using 16797-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 16797-1-AP (LITAF antibody) at dilution of 1:100 (under 40x lens).

• 

  IF Staining of HepG2 using 16797-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HepG2 cells using 16797-1-AP (LITAF antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

LITAF Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 16797-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

PIG7, p53-induced gene 7 protein, p53 induced gene 7 protein, LPS-induced TNF-alpha factor, LPS induced TNF alpha factor

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below
• IHC: See 1 publications below

Product Information

16797-1-AP targets LITAF in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10269

  Product name: Recombinant human LITAF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-119 aa of BC008309

  Sequence: MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSC

• Full Name: lipopolysaccharide-induced TNF factor
• Calculated Molecular Weight: 161 aa, 17 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC008309
• Gene Symbol: LITAF
• Gene ID (NCBI): 9516
• RRID: AB_2135710
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99732
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Lipopolysaccharide-induced TNF factor(LITAF) is a transcription factor that identified as a regulator of TNF-alpha gene expression. It may has a role in protein degradation pathways and in tumor necrosis factor alpha(TNF-alpha) gene expression. Also it may regulate the expression of the CCL2/MCP-1 chemokine through NFKB1.Defects in LITAF may be involved in extramammary Paget disease (EMPD) carcinogenesis

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Mol Neurobiol; LITAF Enhances Radiosensitivity of Human Glioma Cells via the FoxO1 Pathway.; Authors - Changlin Huang ; KD Validated
human	IHC	Nat Commun; Single cell transcriptomic analyses implicate an immunosuppressive tumor microenvironment in pancreatic cancer liver metastasis; Authors - Shu Zhang
	WB	Poult Sci; PRIAM1 participates in the inhibition of inflammation and acetylcholinesterase activity in goose fatty liver formation; Authors - Ying Xue