Tested Applications
Positive WB detected in | mouse brain tissue, rat brain tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
14144-1-AP targets LMX1A in WB, ELISA applications and shows reactivity with mouse, rat samples.
Tested Reactivity | mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag5311 Product name: Recombinant human LMX1A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 283-382 aa of BC066353 Sequence: MEGIMNPYTALPTPQQLLAIEQSVYSSDPFRQGLTPPQMPGDHMHPYGAEPLFHDLDSDDTSLSNLGDCFLATSEAGPLQSRVGNPIDHLYSMQNSYFTS Predict reactive species |
Full Name | LIM homeobox transcription factor 1, alpha |
Calculated Molecular Weight | 43 kDa |
Observed Molecular Weight | 43 kDa |
GenBank Accession Number | BC066353 |
Gene Symbol | LMX1A |
Gene ID (NCBI) | 4009 |
RRID | AB_3085429 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8TE12 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LMX1A is a transcription factor that positively regulates insulin gene transcription. LMX1A also plays a role in the development of dopamine-producing neurons during embryogenesis (PMID: 36381759). LMX1A has 2 isoforms with the molecular mass of 15 kDa (LMX1A-4AB) and 43 kDa (Isoform 1). LMX1A-4AB is expressed in testis. Isoform 1 of LMX1A is expressed in many tissues but not found in heart, liver, spleen and testis.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for LMX1A antibody 14144-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Hariam (Verified Customer) (10-07-2025) | I had a weak signal in iPSC-derived organoid cryosections, it could work better in paraffin embedded tissue or in 2D-cell cultures.
|