LOXL1 Polyclonal antibody

• 

  WB analysis of MCF-7 using 26608-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 26608-1-AP (LOXL1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

LOXL1 Polyclonal Antibody for WB, ELISA

Cat No. 26608-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

lysyl oxidase like 1, LOXL-1, LOXL 1, LOXL, LOL

---

Tested Applications

• Positive WB detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below

Product Information

26608-1-AP targets LOXL1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24293

  Product name: Recombinant human LOXL1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 283-366 aa of BC015090

  Sequence: TPGFEQAYPDPGPEAAQAHGGDPRLGWYPPYANPPPEAYGPPRALEPPYLPVRSSDTPPPGGERNGAQQGRLSVGSVYRPNQNG

• Full Name: lysyl oxidase-like 1
• Calculated Molecular Weight: 63 kDa
• Observed Molecular Weight: 63-70 kDa
• GenBank Accession Number: BC015090
• Gene Symbol: LOXL1
• Gene ID (NCBI): 4016
• RRID: AB_2880573
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q08397
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Three LOXL1 variants are seen: a band of 64 kDa matching the predicted full-length form lacking the secretory signal peptide, a band of 67 kDa presumed to be the full-length form with the signal peptide, and a band of 36 kDa matching the cleavage product.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Oncol; Lysyl oxidase-like 4 exerts an atypical role in breast cancer progression that is dependent on the enzymatic activity that targets the cell-surface annexin A2; Authors - Ni Luh Gede Yoni Komalasari
human	WB	Int J Clin Exp Pathol; LOXL1 regulates cell apoptosis and migration in human neuroglioma U87 and U251 cells via Wnt/β-catenin signaling; Authors - Huiyong Li ; KD Validated