Tested Applications
| Positive WB detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26608-1-AP targets LOXL1 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24293 Product name: Recombinant human LOXL1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 283-366 aa of BC015090 Sequence: TPGFEQAYPDPGPEAAQAHGGDPRLGWYPPYANPPPEAYGPPRALEPPYLPVRSSDTPPPGGERNGAQQGRLSVGSVYRPNQNG Predict reactive species |
| Full Name | lysyl oxidase-like 1 |
| Calculated Molecular Weight | 63 kDa |
| Observed Molecular Weight | 63-70 kDa |
| GenBank Accession Number | BC015090 |
| Gene Symbol | LOXL1 |
| Gene ID (NCBI) | 4016 |
| RRID | AB_2880573 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q08397 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Three LOXL1 variants are seen: a band of 64 kDa matching the predicted full-length form lacking the secretory signal peptide, a band of 67 kDa presumed to be the full-length form with the signal peptide, and a band of 36 kDa matching the cleavage product.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for LOXL1 antibody 26608-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The LOXL1 Polyclonal antibody (Cat# 26608-1-AP) has 3 total citations. These appear in BMC Medicine, Frontiers in Oncology, and International Journal of Clinical and Experimental Pathology. The research fields span lung adenocarcinoma brain metastasis biomarker discovery, breast cancer progression involving LOXL4/annexin A2 interactions, and neuroglioma cell apoptosis/migration regulated via Wnt/β-catenin signaling. All three studies used the antibody for Western blot in human samples.
| Species | Application | Title |
|---|---|---|
BMC Med Downregulated lysyl oxidase in plasma extracellular vesicles: a biomarker linked to brain metastasis risk in lung adenocarcinoma. | ||
Front Oncol Lysyl oxidase-like 4 exerts an atypical role in breast cancer progression that is dependent on the enzymatic activity that targets the cell-surface annexin A2 | ||
Int J Clin Exp Pathol LOXL1 regulates cell apoptosis and migration in human neuroglioma U87 and U251 cells via Wnt/β-catenin signaling
|
