LPCAT3 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• LPCAT3 Monoclonal antibody (67882-1-Ig)

• Featured Product
• KD/KO Validated

LPCAT3 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67882-1-Ig Copied!

Clone No. 1C1G3

Publications (49)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, pig and More (2)

Applications

WB, IHC, IF, ELISA

Synonyms

1-acylglycerophosphocholine O-acyltransferase, 1-acylglycerophosphoethanolamine O-acyltransferase, 1-acylglycerophosphoserine O-acyltransferase, 1C1G3, C3F

• 

  WB analysis of pig stomach using 67882-1-Ig

  pig stomach tissue were subjected to SDS PAGE followed by western blot with 67882-1-Ig (LPCAT3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 67882-1-Ig

  WB result of LPCAT3 antibody (67882-1-Ig; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-LPCAT3 transfected HepG2 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 67882-1-Ig

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 67882-1-Ig (LPCAT3 antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 67882-1-Ig

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 67882-1-Ig (LPCAT3 antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human small intestine using 67882-1-Ig

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 67882-1-Ig (LPCAT3 antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human small intestine using 67882-1-Ig

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 67882-1-Ig (LPCAT3 antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for LPCAT3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: pig stomach tissue, HepG2 cells
• Positive IHC detected in: human stomach tissue, human small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:150-1:600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67882-1-Ig targets LPCAT3 in WB, IHC, IF, ELISA applications and shows reactivity with human, pig samples.

• Tested Reactivity: human, pig
• Cited Reactivity: human, rat, bovine
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6472

  Product name: Recombinant human LPCAT3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 122-233 aa of BC065194

  Sequence: MAYLLAGYYYTATGNYDIKWTMPHCVLTLKLIGLAVDYFDGGKDQNSLSSEQQKYAIRGVPSLLEVAGFSYFYGAFLVGPQFSMNHYMKLVQGELIDIPGKIPNSIIPALKR

• Full Name: lysophosphatidylcholine acyltransferase 3
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC065194
• Gene Symbol: LPCAT3
• Gene ID (NCBI): 10162
• RRID: AB_2918639
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q6P1A2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Lysophosphatidylcholine acyltransferases (LPCATs) are among the lysophopholipid acyltransferases (LPLATs) that play an important role in lipid metabolism and homeostasis by regulating the abundance of different phosphatidylcholine (PC) species. Lysophosphatidylcholine acyltransferase 3 (LPCAT3) is a member of the LPCAT family that primarily regulates the levels of arachidonic PC species. LPCAT3 is abundantly expressed in the testes, kidneys, and metabolic tissues, including the liver, intestine, and adipose tissues. LPCAT3 is involved in the occurrence and development of atherosclerosis, intestinal tumors, and nonalcoholic steatohepatitis (NASH)(PMID: 35711841).

Publications

What published studies show

The LPCAT3 Monoclonal Antibody (1C1G3), catalog number 67882-1-Ig, has accumulated 49 citations published in journals including Nature Communications, Science Advances, Journal of Clinical Investigation, Free Radical Biology and Medicine, Journal of Biological Chemistry, Redox Biology, Cell Death & Disease, and Phytomedicine. The associated research fields primarily center on ferroptosis mechanisms and lipid metabolism, extending into oncology, neurology, cardiovascular disease, inflammation, environmental toxicology, infectious disease, and traditional Chinese medicine.

Automatically generated from the 49 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Exploration (Beijing); A pH responsive nanocomposite for combination sonodynamic-immunotherapy with ferroptosis and calcium ion overload via SLC7A11/ACSL4/LPCAT3 pathway; Authors - Xue Bai
	WB	Nat Commun; Remodeling adipocytes' lipid metabolism with a polycation loaded enzyme-active framework reverses osteoporotic bone marrow; Authors - Wenzheng Lin
	WB	J Adv Res; Modulation of Macrophage ferroptosis under the guide of infrared thermography promotes the healing of pressure injuries; Authors - Xiaoqiong Jiang
human	WB	Redox Biol; Excessive SOX8 reprograms energy and iron metabolism to prime hepatocellular carcinoma for ferroptosis; Authors - Xue Yang
	WB	J Clin Invest; Leukemia-expanded splenic CD81+ erythroblasts potentiate disease progression in mice by reshaping leukemic cell metabolism.; Authors - Yue Li
human	WB	J Exp Clin Cancer Res; Lipid reprogramming induced by the TFEB-ERRα axis enhanced membrane fluidity to promote EC progression.; Authors - Xiaodan Mao