Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 5 publications below |
| IHC | See 2 publications below |
| IF | See 2 publications below |
| CoIP | See 2 publications below |
Product Information
26106-1-AP targets LRP1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23098 Product name: Recombinant human LRP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 20-292 aa of BC045107 Sequence: AIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHLCVFSKSQQEMG Predict reactive species |
| Full Name | low density lipoprotein-related protein 1 (alpha-2-macroglobulin receptor) |
| Calculated Molecular Weight | 505 kDa |
| Observed Molecular Weight | 85-90 kDa |
| GenBank Accession Number | BC045107 |
| Gene Symbol | LRP1 |
| Gene ID (NCBI) | 4035 |
| RRID | AB_3085841 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q07954 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LRP1 (Prolow-density lipoprotein receptor-related protein 1), also known as A2MR, is a multifunctional cell surface receptor that interacts through its cytoplasmic tail with adaptor and scaffold proteins that participate in cellular signaling. It is synthesized in the endoplasmic reticulum as a transmembrane glycosylated precursor that migrates with an apparent molecular mass of about 600 kd on SDS-polyacrylamide gels. After it reaches the Golgi complex, the protein is cleaved to generate two subunits with apparent molecular masses of approximately 515 and 85 kd respectively (PMID: 2112085). It involved in cellular lipid homeostasis. Involved in the plasma clearance of chylomicron remnants and activated LRPAP1 (alpha 2-macroglobulin), as well as the local metabolism of complexes between plasminogen activators and their endogenous inhibitors. Acts as an LRPAP1 alpha-2-macroglobulin receptor. May modulate cellular events, such as APP metabolism, kinase-dependent intracellular signaling, neuronal calcium signaling as well as neurotransmission (PMID:12888553).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for LRP1 antibody 26106-1-AP | Download protocol |
| IP protocol for LRP1 antibody 26106-1-AP | Download protocol |
| WB protocol for LRP1 antibody 26106-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cancer Lett LRP1 induces anti-PD-1 resistance by modulating the DLL4-NOTCH2-CCL2 axis and redirecting M2-like macrophage polarisation in bladder cancer | ||
Acta Biomater Calcium phosphate-mineralized nanoplatform for enhanced ferroptosis and synergistic anti-PDL1 therapy in triple-negative breast cancer through multi-pathway targeting. | ||
Phytomedicine A novel METTL3 inhibitor nimbolide ameliorates osteoporosis via orchestrating osteoclastogenesis in an m6A-dependent manner. | ||
Pharmaceuticals (Basel) Pharmacokinetic and Pharmacodynamic Evaluation of PZ-2891, an Anti-Alzheimer's Disease Agonist of PANK2. | ||
Diabetes Obes Metab Multiomics analysis of O-GlcNAcylation in podocytes of diabetic kidney disease | ||
Lipids Health Dis Lipid infiltration promotes trans-differentiation of vascular smooth muscle cells into macrophage-like cells in early lesions of human coronary atherosclerosis |





