LRRC45 Polyclonal antibody

• 

  WB analysis using 32111-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32111-1-AP (LRRC45 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of A431 using 32111-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using LRRC45 antibody (32111-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

• 

  IF Staining of U-251 using 32111-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed U-251 cells using LRRC45 antibody (32111-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

LRRC45 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 32111-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

LRC45, Leucine-rich repeat-containing protein 45

---

Tested Applications

• Positive WB detected in: HepG2 cells, HeLa cells, HEK-293 cells, U2OS cells
• Positive IF/ICC detected in: A431 cells, U-251 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32111-1-AP targets LRRC45 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36776

  Product name: Recombinant human LRRC45 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 380-512 aa of BC014109

  Sequence: ERKFRCQQEQLFQTRQEMTSMSAELKMRAIQAEERLDMEKRRCRQSLEDSESLRIKEVEHMTRHLEESEKAMQERVQRLEAARLSLEEELSRVKAAALSERGQAEEELIKAKSQARLEEQQRLAHLEDKLRLL

• Full Name: leucine rich repeat containing 45
• Calculated Molecular Weight: 76 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC014109
• Gene Symbol: LRRC45
• Gene ID (NCBI): 201255
• RRID: AB_3670195
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96CN5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The Leucine-Rich Repeat-Containing 45 (LRRC45) gene, a relatively unexplored entity in the realm of genomic studies, has recently garnered attention for its potential role in cellular processes and disease pathogenesis. Characterized by its leucine-rich repeats, a motif known for facilitating protein-protein interactions, LRRC45 is implicated in various cellular functions, including signal transduction and intracellular trafficking. LRRC45 promotes lung cancer proliferation and progression by enhancing c-MYC, Slug, MMP2, and MMP9 expression (PMID: 39326735).